SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010137 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010137
Domain Number 1 Region: 23-255
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.27e-70
Family BAR domain 0.00042
Further Details:      
 
Domain Number 2 Region: 247-279,311-368
Classification Level Classification E-value
Superfamily SH3-domain 5.83e-18
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010137   Gene: ENSGALG00000006284   Transcript: ENSGALT00000010151
Sequence length 369
Comment pep:known chromosome:WASHUC2:8:16640782:16657740:-1 gene:ENSGALG00000006284 transcript:ENSGALT00000010151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPKMNIMDFNMKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKQWTE
KIMKQTEVLLQPNPNARIEEFFYEKLDRKAPSRMNNPELLGQYMIDAGNEFGPGTAYGNA
LIKCGETQKQIGTADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKT
RLKKAKVAEARAASEQEVRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTY
YAQCYKYMLDLQKQLGSFPSTFLSNNNQSSSAPVQSVSTPSVLASASASLPSVSNSVVTS
GISELKSSSGSRKARVLYDYDAANSSELSLLADEVITVYSIPGMDSDWLMGERGNQKGKV
PITYLELLN
Download sequence
Identical sequences 9031.ENSGALP00000010137 ENSGALP00000010137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]