SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010515 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010515
Domain Number 1 Region: 309-405
Classification Level Classification E-value
Superfamily Immunoglobulin 5.57e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 461-745
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 3.53e-20
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.044
Further Details:      
 
Domain Number 3 Region: 42-110
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000194
Family Ovomucoid domain III-like 0.0088
Further Details:      
 
Domain Number 4 Region: 151-227
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000178
Family Calmodulin-like 0.053
Further Details:      
 
Domain Number 5 Region: 233-322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000385
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010515   Gene: ENSGALG00000006514   Transcript: ENSGALT00000010529
Sequence length 807
Comment pep:known chromosome:WASHUC2:13:16850514:16873962:1 gene:ENSGALG00000006514 transcript:ENSGALT00000010529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLDGSRRPHSDLGRLHQEVSGRFEVTRRKVLYGQDGLHASCEKKYCGRGSRCVVNRDTN
QPECRCVEDCKSSYMPVCGSDGKFYENHCQLHRASCLQRKKIYIIHSKDCFFKGDTCTMA
SYRQLKGVVLELQAQRSAPPRRPPADRAAQKRALVEELFQHLDANGDGHLSSSELAQVMK
KEDLEDDLLDCTLEDLLRFDDYNNDGHLTLQELYTAFQVVQLSLPEEQRVSITTITVGLS
TILTCSIRGALRPPIIWKRNGIILNFLDLEDINDFGEDDSLYITKVTTIHMGNYTCHAYG
YEELYQTHILQVNVPPVIRVYPETQAQEPGVSASLKCHAEGIPNPRITWLKNGMDIVPKL
SKQLTLLANGSELHISSVRYEDTGAYTCIAKNEVGVDEDISSLFIEDSARKTRLSVGNMF
YVFSDDGITVLQPNECEIRRHIGPEERIFSTYEEICPRVEGEGAQSCLWASAVNVRDKYI
YVTQPKQNRVVVIDIQTQKAVQSVDVDPLPTKLHYDKSHDQVWVLSWGDMRRSSPTLQVI
PEASAGEEQHVIRTPFKGVDDFFIPPTNLIINHVRFGFIYNKSKPAVHKIDLETVTHIKT
ISFRNYSCAPQTMAYTHLGGYFLVQCRDRRGAAAPQLLIDSVTDTVIGSNGAVLGTPHVS
PDGRFLVSTDGDAGRIQVQTVTVQGEIKLIYDLQTNIHVSDLTFQPSFTEGNQYYIYATS
HLQTDVLVVELSTGKMNVLKNLKDPITSKDWPWSSYNRIVKDSGLFGQYLITPAKDSLFV
INGRQNTLRCEVSGIRRGNTVVWVGEV
Download sequence
Identical sequences NYSGRC-IgSF-NP_989833 ENSGALP00000010515 9031.ENSGALP00000010512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]