SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010820 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010820
Domain Number 1 Region: 308-467
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-59
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000169
Further Details:      
 
Domain Number 2 Region: 146-307
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000448
Further Details:      
 
Domain Number 3 Region: 109-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000367
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 67-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000135
Family EGF-type module 0.026
Further Details:      
 
Domain Number 5 Region: 26-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family EGF-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010820   Gene: ENSGALG00000006702   Transcript: ENSGALT00000010834
Sequence length 468
Comment pep:known chromosome:WASHUC2:10:14720343:14726661:1 gene:ENSGALG00000006702 transcript:ENSGALT00000010834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTVRQWRAPLLLALGLTLLVVVAGDFCSVNYCQNGGTCLTGINETPFFCICPEGFVGID
CNETEKGPCHPNPCHNNGECQLVPNRGDVFTDYICKCPTGYDGVHCQNNKNECSSEPCKN
GGTCVDMDGDYACKCPSPFFGKTCHARCAIPLGMEGGAISDAQLSASSVYYGFLGLQRWG
PELARLNNHGIVNAWTSSNYDKSPWIQANLLRKMRLSGVITQGARRVGKAEYVRAYKVAY
SLDGREFTFYKDEKLNTDKVFQGNVDYGTMQTNMFDPPITAQYIRIYPVVCRRACTLRLE
LIGCEMNGCSEPLGMKSRLISDQQITASSVFKTWGIDAFTWYPHYARLDKMGKTNAWTAL
HNDQSEWLQIDLRDQKKVTGIVTQGARDFGHIQYVAAYKVAYSDNGTSWTVYRDSQTNST
KIFHGNSDNYSHKKNVFDVPFHARFVRILPVAWHNRITLRVELLGCDE
Download sequence
Identical sequences ENSGALP00000010820 NP_001264040.1.86415 9031.ENSGALP00000010820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]