SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010987 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010987
Domain Number 1 Region: 915-965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000212
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 2 Region: 963-1014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000977
Family Laminin-type module 0.0031
Further Details:      
 
Domain Number 3 Region: 808-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000014
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 4 Region: 854-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 5 Region: 329-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000628
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 6 Region: 265-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 7 Region: 760-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 452-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 504-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 10 Region: 1071-1113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 11 Region: 392-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 1015-1068
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000565
Family Laminin-type module 0.0021
Further Details:      
 
Domain Number 13 Region: 1119-1167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000010987
Domain Number - Region: 1425-1627
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0102
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010987   Gene: ENSGALG00000006802   Transcript: ENSGALT00000011001
Sequence length 1773
Comment pep:known chromosome:WASHUC2:12:11830498:11846043:1 gene:ENSGALG00000006802 transcript:ENSGALT00000011001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLVLALLLAGVPAAGGWEEPDPSQGCARGSCYPATGNLLVGRARQLSASSTCGLQGPQ
EYCIVSHLQDSEKCFTCDSRNPALRESHRIENVIYLHGPHSERSWWQSENGVERVSIQLD
LEGEFHFTHLIMKFKTFRPAAMLVERSADFGRSWKVYRYFAYNCSKLFPGIATHPSGHIG
EVLCEQRYSEIEPSSHGEVIFKVLDPSIPVVDPYSPDIQELLRVTNLRVNLTKLHTLGDN
LLDSRREVLHKYYYAVDELVMRGSCFCHGHAAECAPAPGAPPSVPGMIHGRCVCKHHTQG
LNCERCEDFYHELPWRPAEGSSTNACRRCDCNEHSRRCHFDMAVFLATGNTSGAVCDGCQ
HNTMGRRCHLCKPFYYRHPRSDIRAPTACVPCDCDPAGSLDGGACDAHTDVALGMIAGQC
RCKENVAGPRCDRCQHGAYGLSQGDPQGCQRCLCDPRGTVADGSQCDPISGDCLCKRLVT
GRSCDQCLPEHWALSHDLPGCQPCECDVGGAHDNQCAMETGQCRCRSHIVGRQCEQVEPG
FYRINLDHYTYEAEDARLHMGSVVQREPHAGHLASWTGSGFARMQEGGWVEFHVSDVPFS
MEYDVIIRYEPQHPEPWKEVRMQVLRPSPVSASSPCGNTIPADDQLSTSLLSGARYVVLP
RPICLERGVSYTIRLELGCATGQQDPTASVLIDSLVLLPRYSSMEMFIAGDPAAMGRRET
FERYRCAQHFHTVVLSPVAEPCSRLLHSLSAILHNGALPCLCDPQGLLSAECQPQGGQCR
CKPNVVGRRCHRCSPGTFGFGPGGCRPCQCSGEGSLSAVCDTITGQCPCRQGAHGSRCDR
CQPGHWGFPTCRPCQCNGHAEECDPQTGSCLRCRDHTDGERCQRCAAGHFGNPALGSGQH
CRPCPCPDGPGGPRHFAASCYQDGRSRQVVCHCSPGYTGPRCDECAPGYYGDPLQPGGHC
RPCQCHNNIDTTDPEACDRRTGQCLRCLYNTAGPHCAECQPGYYGDAMRHSCRRCSCNTL
GTDPNTCGPQQCQCDQRSGQCHCLPHVEGQSCDRCSPNFWNLGSGQGCEPCACHPQHSLS
PACNQFTGQCSCRPGFGGRTCANCQEQHWGDPRLQCRACDCDPRGIASTQCHHGSGHCDC
RPGISGVRCDQCARGFSGTFPACQPCHPCFGDWDRVVQDLASPGLWEQRAQPSLQHTGSC
PGALRGAPFRRLEESLATIRDAVAARNATAATATFLTRATEGFAVSTGEKLTRLESELTV
AQDANFNASHVLGMVDRGARTLNHSLRELEQRLHALKTSNFLGAFDSIRQSHWESQDAER
RADASTRVVPSPVSASSATRHHTEQLLASRRDAFNRQNAASRRALTELAARARELSLQPV
NKKVCGAAGDVPCAESPCGGAGCRDEDGARRCGGLSCSGAVSTADSALDRARHAQEELRR
AAGEVAQLSHRVAEAKGKADEARLQAQAALDKANQTRARVEHSNKELRELISHVKAFLSQ
EGADPESIEVVASRVLELSLPASPAQIHRLAEEIKARVRNRASVDAILEQTAGNRRQAGQ
LLQDAQRAKARAEGVRGTAEAVQQALEEARQAQGAAGQALHSTAADIQHSEHTIGTMRAQ
TLGAEQQLAAATERLGLLEGQTDALKVKRANNSLAATRAHDAAGIARDRASEAKQVLEGP
LKDRYRAAQELVQHRAQGAQQAGGRAQQLREEAAGLLQDAQGKLQKLRALEEAYERNERV
LDAKVAQLDGLEARMREVLATINQQVQIYNTCQ
Download sequence
Identical sequences 9031.ENSGALP00000035462 ENSGALP00000010987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]