SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011948 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011948
Domain Number 1 Region: 525-771
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-62
Family Nuclear receptor ligand-binding domain 0.00000000075
Further Details:      
 
Domain Number 2 Region: 413-495
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.1e-27
Family Nuclear receptor 0.0000126
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000011948
Domain Number - Region: 299-338
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0602
Family Pentapeptide repeats 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011948   Gene: ENSGALG00000007394   Transcript: ENSGALT00000011962
Sequence length 772
Comment pep:known chromosome:WASHUC2:13:17984148:18034839:-1 gene:ENSGALG00000007394 transcript:ENSGALT00000011962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKELLKSSDQDETRKNALMSTKGGIVMDFHPPFRGGASAQAPVSAAPLPVSSQSDSAQ
QPALADFSKGLVNNVPPPDLSKAVSLSMGLYMGETDAKVMGNDLGFSQQGQTGISSGETD
FRLLEESIASLNKSSSLAEDAKGAVSSEAPLEPDFVGMAGRGPLEPGASVQSQVGSNGGS
LKLFSEDQSTLDILQDLELPSVSPGKEPNGSPWRLDPLLDDGGLLSPISADDTFLLEGNL
GEDCKPPILSDTKPKINDRGDLLPSSKMPMPQVKTEKEDFIELCTPGIKQENVGPIYCQA
NFSGSNMLGTKVSAISIHGVSTSGGQMYHYDLNTASLSQQQDQKPIFNIIPSLPAGSENW
NRCQGSGDEALAPLGTLNLSGRPAFSNGYSSPGLRSDVSSSPSTTSATAGPPPKLCLVCS
DEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAG
MNLEARKTKKKIKGIQQTTATGTREAAEAAGNKSVVPASLPQLTPTLVSLLEVIEPEVLY
SGYDSTLPDSSWRIMSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMA
FALGWRSYKQSNGNLLCFAPDLIINEQRMNLPCMYEQCKHMLMVARELSRLQVSYEEYLC
MKTLLLLSTIPKEGLKSQTLFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSM
HDVVENLLSFCFQTFLDKSMSIEFPEMLAEIISNQIPKYSNGNIKKLLFHQK
Download sequence
Identical sequences A0A1D5PRD7
ENSGALP00000011948 ENSGALP00000011948 9031.ENSGALP00000011948 XP_015149519.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]