SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000012728 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000012728
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.84e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000745
Further Details:      
 
Domain Number 2 Region: 182-305
Classification Level Classification E-value
Superfamily E set domains 1.47e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000012728   Gene: ENSGALG00000007845   Transcript: ENSGALT00000012742
Sequence length 598
Comment pep:known chromosome:WASHUC2:3:2007462:2039490:1 gene:ENSGALG00000007845 transcript:ENSGALT00000012742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGISEPYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFGKVKI
RTTLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGIQCVKKKDLKESISL
RISKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLISNPIYDNRAP
NTAELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVA
IVFRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDFRYLPDEKDPYGNKAKRQRSTLAWQ
KLIQDCGSAVTERPKAVPIPTVNPEGKLIKKEPNMFSPTLMLPGLGTLTSSSQMYPPCSQ
MPHQPAQLGPGKQDTLPSCWQQLFSSSPSASSLLSMHPHNSFTAEVPQPSAQGSSSLPAF
HDNPLNWPDEKDSSFYRNFGSTNGMGAAMVSAADMQSASSNSIVHATHQASATAASIVNM
ETNDMNCTSLNFEKYTQVLNVSNHRQQLHQAPAACPPVAAPGSTPFSSQPNLADTAVYNS
FLDQEVISDSRLSTNPLQNHQNSLTLTDNQFYDTDGVHTDELYQSFQLDTNILQSYNH
Download sequence
Identical sequences F1P3A5
NP_001161198.1.86415 9031.ENSGALP00000012728 ENSGALP00000012728 ENSGALP00000039504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]