SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000012817 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000012817
Domain Number 1 Region: 813-861
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000026
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 765-815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000126
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 3 Region: 859-911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000234
Family Laminin-type module 0.0042
Further Details:      
 
Domain Number 4 Region: 326-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 5 Region: 262-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000523
Family Laminin-type module 0.039
Further Details:      
 
Domain Number 6 Region: 968-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.0027
Further Details:      
 
Domain Number 7 Region: 501-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 8 Region: 920-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 9 Region: 449-493
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 10 Region: 1077-1119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 11 Region: 1125-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 12 Region: 406-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 13 Region: 1020-1074
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000181
Family Laminin-type module 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000012817
Domain Number - Region: 1583-1768
Classification Level Classification E-value
Superfamily Tropomyosin 0.000451
Family Tropomyosin 0.0036
Further Details:      
 
Domain Number - Region: 1289-1408
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00114
Family C-terminal domain of PLC-beta 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000012817   Gene: ENSGALG00000007905   Transcript: ENSGALT00000012832
Sequence length 1782
Comment pep:known chromosome:WASHUC2:1:15859501:15899985:-1 gene:ENSGALG00000007905 transcript:ENSGALT00000012832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLSPAALRVAVAQEPEYSYGCAEGSCYPATGDLLIGRAARLSASSTCGLRQPEPYCIVS
HLQEDKKCFICDSEDPFHDTLNPDSHRIENVVTTFAPNRLKLWWQSENAFQIIHVFCNRL
GSIHTEKFLAHKTFRPAAMLIERSSDFGKTWQVYRYFAYDCESSFPGISTGPMKKVDDII
CDSRYSDIEPSTEGEVIYRVLDPAFRIEDPYSPRIQNLLKITNLRVKFTKLHTLGDNLLD
SRMEIREKYYYAIYDMVVRGNCFCYGHASECAPVEGFSEEVEGMVHGHCMCRHNTKGLNC
EQCLDFYHDLPWRPAEGRNSNACKKCNCNGHSTQCHFDMAVYMATGNTSGGVCDDCQHNT
VGRNCEQCKPFYFQHPERDLRDPDVCEPCNCDPAGSQNGGVCDRYTDFSTGLIAGQCRCK
LFVEGERCDLCKEGFYGLSADDPSGCQSCACNPLGTHPGGNPCDSETGNCYCKRLVTGKQ
CNQCLPEHWGLSNDMDGCRPCDCDQGGALHNNCSSESGQCECRPHMFGRQCNQVEPGYYF
ISLDHYIYEAEEANLGPGVNIIERQSTQDRTPSWTGIGFVRVPEGAYLEFNIDNIPYSME
YDIVIRYEPQQLPDQWEKAVVTVSRPGRIAAGSRCGNTVPDDDNQVVSLPPGSRYVVLPR
PVCFEKGLNYTIRLELSQYSLVESEMENPYTLIDSLVLMPYCKSLDIFTVGGSGEDVVTN
SAWETFQRYRCLENSRSVVKTPMTDVCKNIIFSISALLHETALSCQCDPQGSLSSVCDPS
GGQCQCRPNVVGRQCNRCAPGTFGFGPSGCRPCECHLRGSYNSFCDAETGQCHCFPGVYG
RQCDRCLPGFWGFPSCQPCHCNGHADDCSPYTGECLHCRDHTAGPNCERCEAGYYGDPIL
GSGDHCRPCPCPDGPESGRQFASGCYQDPVTLQVVCVCSTGYIGSRCDECASGFFGSPDE
VGGACQPCQCNNNIDSTDPEACDKRTGTCVKCLYHTEGENCHLCRQGYYGSALQQDCRKC
VCNYLGTVREDCDDAENCRCEAATGQCRCLPGVVGQTCDRCAPNTWRLASGTGCEPCDCD
TARSIGLACNEFTGQCHCMPGFGGRTCRECQELFWGDPSVECRACDCNPRGIQTPQCDRA
TGQCICNEGVEGPRCDKCSRGYSGFFPDCVPCHQCFALWDVIVGELTNRTQQFLDRANAL
KITGVVGPYQQTLSTLEEKLGEIKAIIAQNPAAEPLKNIGNLFEEADKLTADVTVKIADI
EASLSTLAEKSNSTDADLSALETDAKSLDRVVKELAEQLEFIKISDVRGALDSITKYFQM
SLEAEERVNASTVHPDSAVELSAQTRQEVEDLINEKEAQFKAKQEEQSRLLDELAGKLQS
LDLAEASAKMCGTPVGASCAESECGGLHCRTAAGQRKCGGPGCDGLVTVAHNAWQKAMDF
DRDILSALAEVEQLSRMVSEAKQRADEAKQNAQEVLLKTNATKEQVDRSNEDLRNLIKQI
RDFLMQDSADLDSIEAVANEVLNMEMPSTPEQLQALTEDIRERVESLSDVEVILQQSAGD
IARAEMLLEEAKKASKGAKDVKVTADMVKAALEEAEKAQDAAEKAIKQADEDIKGTQDLL
TSIQSENAASEETLNNATLRLFALERSVEDLKQKAATNSENVGNIEEKIISAKQNAEEVK
QEQQVLDTELNSKYKTVEDLITKKTEESADARRKAGLLQEEAKALLAQANSKLQLLKELE
NTYENNQKVLEDKAKQLVELEETVRSLLQTISQKVAVYSTCL
Download sequence
Identical sequences 9031.ENSGALP00000012817 ENSGALP00000012817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]