SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013341 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013341
Domain Number 1 Region: 168-407
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-72
Family Nuclear receptor ligand-binding domain 0.00000000225
Further Details:      
 
Domain Number 2 Region: 57-142
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-29
Family Nuclear receptor 0.0000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013341   Gene: ENSGALG00000008202   Transcript: ENSGALT00000013356
Sequence length 409
Comment pep:known chromosome:WASHUC2:5:25261738:25273227:-1 gene:ENSGALG00000008202 transcript:ENSGALT00000013356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPTQLSTQDHGKRVASVFEMEEEGLSLFSGSENPPKHAENPPLKRKKGPAPKMLGNEVC
SVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAQYVCKNGGKCEMDMYMRRKCQECRLRKC
QEAGMREQYVLSEEQIRLKKLKKQEDDQARTVVVRPNPPQPPSPSHQLTPEQLNMIEKLV
AAQQQCNQRSFTDRLKVTPWPQVPDPNNREARQQRFAHFTELAIISVQEIVDFAKQLPGF
RELTREDQIALLKTSTIEVMLLETSRRYNPEIESITFLKDLSYNRDDFAKAGLQFEFINP
IFEFSKGMNELQLNDAEYALLIAINIFSADRPNVQDQSLVERLQHTYVEALHSYICINRP
NDHLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences G1NE58 Q8JHU1
ENSGALP00000013341 NP_989873.1.86415 XP_015719791.1.68032 XP_015719792.1.68032 XP_015719793.1.68032 XP_021257087.1.32913 XP_021257088.1.32913 XP_021257089.1.32913 XP_021257090.1.32913 XP_021257091.1.32913 ENSMGAP00000011186 ENSGALP00000013341 ENSMGAP00000011186 9031.ENSGALP00000013341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]