SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013426 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013426
Domain Number 1 Region: 82-151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.78e-17
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 2 Region: 225-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000502
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 3 Region: 140-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000493
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000013426
Domain Number - Region: 198-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00217
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013426   Gene: ENSGALG00000008260   Transcript: ENSGALT00000013441
Sequence length 351
Comment pep:known chromosome:WASHUC2:3:3147715:3155309:1 gene:ENSGALG00000008260 transcript:ENSGALT00000013441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLCCSLPLLLPLLLLCPAARPATPAAQGCPGRQQLLAAVRQMQQLLKGQETRFTEGLRMM
KSRLSTLHAALAKAAPEPAPAVFCPAPQAPAGGRMFGTKYLVEHEVHFACEPGFELQGSS
TRICQTDGSWSGQEPRCTELSTCSSNPCQNGGTCVEGPGQHRCLCPPPWSGAACQHRTQT
EPPARSVTADPAFSRKPRCAQVEHAQQCRCEPGFHMSGTAAASLCQDVDECELYQAEGAP
RLCAHACVNLPGSYRCACPSGYSLLADGKSCEDIDECALSRDNCTRGTTCINTGGGFQCV
NPCPQPGGNITYVKTSPFQCERNPCPMDSRSCHQAPKTISFHYLPLPSNLL
Download sequence
Identical sequences ENSGALP00000013426 9031.ENSGALP00000013426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]