SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013502 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013502
Domain Number 1 Region: 162-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.41e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 31-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000111
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 3-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000435
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000013502
Domain Number - Region: 92-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0156
Family LIM domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013502   Gene: ENSGALG00000008303   Transcript: ENSGALT00000013517
Sequence length 402
Comment pep:known chromosome:WASHUC2:15:12879463:12887869:1 gene:ENSGALG00000008303 transcript:ENSGALT00000013517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKCNLTEKCFFREGKLYCKKNFFRRF
GTKCAGCSQGISPSDLVRKARNKVFHLNCFTCMVCNKQLSTGEELYIIDENKFVCKEDYL
NSPSLKEGSLNSVSSCTDRSLSPDLQDPMQDDTKETDNSTSSDKETTNNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYGPGGNYDFFPHGP
PSQAQSPADPSYLQNSGPGSTPLGPLEPPLSGHHSSENQRYTDMISHPDTPSPEPGMTGS
LHPIPGEVFSGGPSPPFSMSSNSGYSGALAHPNPELSEAAVW
Download sequence
Identical sequences ENSGALP00000013502 9031.ENSGALP00000013502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]