SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013737 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013737
Domain Number 1 Region: 1195-1535
Classification Level Classification E-value
Superfamily NHL repeat 9.42e-24
Family NHL repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 1433-1596,1646-1744
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.000000248
Family Soluble quinoprotein glucose dehydrogenase 0.046
Further Details:      
 
Domain Number 3 Region: 893-974
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000157
Family Pre-dockerin domain 0.093
Further Details:      
 
Domain Number 4 Region: 634-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000542
Family Integrin beta EGF-like domains 0.076
Further Details:      
 
Domain Number 5 Region: 702-726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000986
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000013737
Domain Number - Region: 732-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000789
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 568-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000789
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 603-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000887
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 770-802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 1611-1744,1868-1962
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00719
Family SGL-like 0.048
Further Details:      
 
Domain Number - Region: 2102-2200,2292-2352
Classification Level Classification E-value
Superfamily NHL repeat 0.0314
Family NHL repeat 0.014
Further Details:      
 
Domain Number - Region: 538-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0493
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013737   Gene: ENSGALG00000008442   Transcript: ENSGALT00000013752
Sequence length 2736
Comment pep:known chromosome:WASHUC2:4:15414755:15646471:1 gene:ENSGALG00000008442 transcript:ENSGALT00000013752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQMDCKPYQPLSKVKHEVDLTYTSSSDESEDGRKQRQSYDSRETLNEYSQELRLNYNSQ
SRKRKNTDQSTQDMEFCETPHILCSGYQTDLHGVSEHSYPLEVGSDVDTETEGGASPDHA
LRMWMRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENAFESIPLCCAAPWPSDSLQNM
PGSPHNQFTFRPLPPPPPPPHACTCTRKPPPAADSLQRRSMTTRSQPSPAAPTPPTSTQD
SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRNTF
SRPAFTFSKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGQLYENG
VSKGNKGAESTDTTYSPIGGKVSDKTEKKGKSVFQKGRAIDTGEVEIGAQVMQTIPPGLF
WRFQITIHHPVYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLIKQEPKNSE
EPQQAPRNLILTSLQETGFIEYMDQGAWHMAFYNDGKKVEQVFVLTTAIEVLDDCSTNCN
GNGECISGHCHCFPGFLGPDCAKDSCPVLCSGNGEYEKGHCVCRNGWKGPECDVPEEQCI
DPTCFGHGACIMGVCICVPGYKGEICEEEDCLDPMCSGHGVCVQGECHCSAGWGGVNCET
SLPICQEQCSGHGTFLLDVGLCSCEPQWTGSDCSTELCTLDCGSHGVCSRGICQCEEGWV
GPTCEERTCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRVDGCPGLCYGNGRCT
LDQNGWHCVCQVGWSGSGCNVVMEMACGDNLDNDGDGLTDCVDPDCCQQNNCYASPLCQG
SPDPLDLIQHSQPPFSQHPPRLFYDRIRFLIGKESTHVIPGDISFESRRACVIRGQVVAI
DGTPLVGVNVSFLHHDEYGYTISRQDGSFDLVAVGGISVTLVFDRSPFISEKRTLWLSWN
RFVIVDKVVMQRAESDIPSCDVSSFISPNPIVLPSPLTAFGGSCPERGTVIPELQVVQEE
IPIPSSFVKLSYLSSRTPGYKTLLRVILTHTTIPSGMTKVHLIIAVEGRLLQKWFPAAAN
LVYTFAWNKTDIYGQKVSGLAEAMVSVGYEYETCPDFILWEKRTVILQGFEMDASNLGGW
SINKHHVLNPQSGIVHKGNGENMFISQQPPVISTVMGNGHQRSVSCSNCNGLALNSKLFA
PVALTSGPDGSVYIGDFNFVRRIFPSGNSIGILELRNRDTRHSTSPAHKYYLAVDPVSES
LYLSDTNTRRVYKAKSLIETKDLAKNVDVVAGTGDQCLPFDQSHCGDGGKASEASLNSPR
GITIDKHGFIYFVDGTMIRKIDENGMITTIIGSNGLTSTQPLSCDSGMDITQVRLEWPTD
LTVNPLDNSLYVLDNNIVLQISESRRVRIIAGRPIHCQVPGIDHFIVSKVAIHSTLESAR
AIAVSHSGILYIAETDERKINRIQQVTTNGEISIIAGAPSDCDCKIDPNCDCFSGDGGYA
KDAKLKAPSSLAVSPDDTLYVADLGNIRIRAVSRNKAHLSDTNMYEIASPADQELYQFTI
NGTHLHTLNLITRDYIYNFTYSGEGDVATITSSNGNSVHIRRDTSGLPLWVVVPGGQVYW
LTISSNGVLKRVYAQGYNLALMTYPGNTGLLATKSDENGWTTVYEYDSDGHLTNATFPTG
EVSSFHSDVEKLTRVELDTSNRENMVTATNFSATSTIYTLKQDNTQNIYRVSPDGSLRVT
FASGMEITLNTEPHILAGVVSPTLGKCNISLPGEHNSNLIEWRQRREQTKGNISTFERRL
RAHNRNLLSIDFDHVTRTGKIYDDHRKFTLRIMYDQTGRPVLWSPISKYNEVNITYSHSG
LVTYIQRGTWTEKMEYDPSGNIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSD
YLLSVTMPSMVRHALQTMLSVGYYRNIYTPPDSGAAFIQDVTRDGRLLQTLYPGTGRRVL
YKYSKQSRLSEILYDTTQVTFTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRF
SEEGLVNARFDYSYNNFRVTSMQAMINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQ
VITTTVMKHTKIFSANGQVIEVQYEILKSIAYWMTIQYDNMGRMVICDIRVGVDANITRY
FYEYDADGQLQTVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQ
YKMDEDGFLRQRGNEIFEYNSNGLLNKAYNKVSGWTVQYCYDGLGRRVASKSSLGQHLQF
FYADLSNPIRVTHLYNHSSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSS
RGQVIKEILYTPYGEIYQDTNPDFQVVIGFHGGLYDSLTKLVHLGQRDYDVIAGRWTTPN
HHIWKHLNAVPQPFNLYSFENNYPVGRIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPE
IEALETTYELLQLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYSDGKCYEG
VKQPRFAAIPSVFGKGIKFAIKDGIVTADIIGVANEDSRRIAAILNNAHYLENLHFTIEG
RDTHYFIKLGSLEEDLSLIGNTGGRRILENGVNVTVSQMTSVINGRTRRFADIQLQHGAL
CFNVRYGTTVEEEKNHVLEVARQRAVAQAWTKEQRRLQEGEEGIRAWTDGEKQQLLNTGR
VQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences 9031.ENSGALP00000031671 ENSGALP00000013737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]