SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013906 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013906
Domain Number 1 Region: 873-1093
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-39
Family DBL homology domain (DH-domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 1248-1447
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-32
Family Pleckstrin-homology domain (PH domain) 0.00014
Further Details:      
 
Domain Number 3 Region: 1079-1195
Classification Level Classification E-value
Superfamily PH domain-like 4.88e-23
Family Pleckstrin-homology domain (PH domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013906   Gene: ENSGALG00000008546   Transcript: ENSGALT00000013922
Sequence length 1449
Comment pep:known chromosome:WASHUC2:12:20438694:20514892:-1 gene:ENSGALG00000008546 transcript:ENSGALT00000013922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGPKPPIAPKPKLSADTESRSSVNTNNNLNKCSNCKLLCLDGELCDGNQCSAECPEAE
ADDEYIVLPETQLTNKDCNDLEHKHDQSLDSFAVNEVLEIPEEAEKEEDNIPNHESADSQ
EIKHHNFSDIAEPIKPDSVSSTRDRGQSEAFCEELSDATGGNNDVSKNVDEDKDVAAELI
PSLEKSGEEKEEELSEILGKGDRCPAHDGDHSVYAELDLNMQDELENDDCTSPDMLPNEA
SEKTVWCLELPEGEPNAENGLGDSTHQAAAEEEEADTDKHNNTNTGNVSDDCQITDLRGE
ETSEVACEASKDSGKREEETVNAESINDGCQIAPSENDDGEEVPTNRQTEETCPEEDGQI
SDTLPSGPGMETKLEDMSAEEHNESIAEMSKSDELQLEGNKEKLALPEVVIVPEESERRE
TGSDSLDDPYVLPAENEFTHKGQTDSGADHSKRDELDMDGESNLLLIDRKSIVTRTRSLS
GRMPGYVPETVPEEGGPETDLPPSCNSSGTEDLSNSSFSVEGKTLEDNKALPSKPRHFIL
YPRSYSVEGREIPISIYKEGDGCVLSDIRMKKTEDNLSLPCVNGSSHIFSQGNLSSGAVS
TPSSVVDIPPPFELAYITKKPITKSSPSLLIENESPDKYSKKKKSSFKRFLTLKFKKKTE
NKIHVDVNVSSSRSSSESSYHGPPRLMELDRTLSSSPQLKSHVGKLRASESPSTVFFYKD
GKRKGTPKSFSRSVSRVESFEDRSRPPFMPLPLTKPRSISFPNADTSEYENIPAMSSDYE
NIQIPPRRSTRAGTFTEFFEDPSRALSAANENDGYVDMSSFTGFENKQQTTDQETESAYT
EPYKVCPVSVIPAEVITSDEEQRSSEDEKSSQGDPSLINKKEGQPRASLIAQELMSSEKA
YVEMLQLLRMDLYEGILKALGEEDEQEVVELKQGLSELPEMYELHQEILGELEERVLKWE
EHQKVADVFLSRKSRLNHHTAYITQFDKNLALLDETCLKYSQLATVIQEFEKSSGGSPQN
VKHQLLKVVQRVFQYRVMLTDYLNNLCPDSTEYEATQAALFIVSEIADRANESMLQGENL
QKLVHIEHSVRGQSGLLQPGRIFVKEGTLMKVSGKNRHPRHLFLMNDVLLYTYPQKDGKY
QLKNTLVVSDMKVSRPVTEKAPNVLKIECDEYCLTLSASSCLERDDWYSCISRHIPDDCK
AHNTSTCHSNVELRERLGIPLGERPPTLVPVSHVMMCMNCGCDFTLTLRRHHCHACGKIV
CRNCSRNKYPMKYLRDQAAKVCDSCYVELKKRGKVSPFLLTERPLSVSFPPTSSRCSSSA
FSSVFHNIHYSSFKKQKKIPSALTEVAASGEGATISGYLTRCKRGKRHWKKRWFVIKGKV
LYTYIANEDKVATESLPLLGFTVAPEKEEGCIDTVFHLYHKQTLFYSFRADDNYSAQRWI
EAMEEASIL
Download sequence
Identical sequences 9031.ENSGALP00000013906 ENSGALP00000013906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]