SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014047 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014047
Domain Number 1 Region: 351-489
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-43
Family C-type lectin domain 0.00013
Further Details:      
 
Domain Number 2 Region: 1220-1363
Classification Level Classification E-value
Superfamily C-type lectin-like 4.72e-38
Family C-type lectin domain 0.00027
Further Details:      
 
Domain Number 3 Region: 634-780
Classification Level Classification E-value
Superfamily C-type lectin-like 5.23e-37
Family C-type lectin domain 0.00000643
Further Details:      
 
Domain Number 4 Region: 931-1085
Classification Level Classification E-value
Superfamily C-type lectin-like 4.14e-36
Family C-type lectin domain 0.00038
Further Details:      
 
Domain Number 5 Region: 793-924
Classification Level Classification E-value
Superfamily C-type lectin-like 6.65e-36
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 6 Region: 500-639
Classification Level Classification E-value
Superfamily C-type lectin-like 6.07e-34
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 7 Region: 21-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.63e-33
Family Cysteine rich domain 0.00000239
Further Details:      
 
Domain Number 8 Region: 1093-1221
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-30
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 9 Region: 228-343
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-28
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-20
Family Fibronectin type II module 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014047   Gene: ENSGALG00000008629   Transcript: ENSGALT00000014063
Sequence length 1457
Comment pep:known chromosome:WASHUC2:2:19502036:19546532:-1 gene:ENSGALG00000008629 transcript:ENSGALT00000014063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKLHEAARSVSLLPCCFHLTDTSTFLIYNEDHKRCVLAQSSNSVTTTPCVQENESQKFRW
VSDHQLMSIAFKLCLGVPSKKDWVPVTLYPCDKASELQRWECRNETLFAIQGEDLFFNYG
NRQERNIMLYKGSGLWSRWKVYGTTDDLCSRGYEDTYTVRGNAEGAPCVFPFKFGNKWYA
DCTDAGRADGWFWCGTTADYDVDRRYGFCPLKINSIDSLWNTDPLTNVQYQINSESALTW
HQARKSCQQQKAELLSITELHEQTYLAGLTGKLSSALWFGLNSLNFDSGWQWVGGAPFRY
LNWVPGHPSPEPGKICAALNPGKVAKWENWECNQKLGYICKRGNATLASFIVPAETGVPI
RCPDQWISYAGHCYIIHRDPKIWKDALTSCRKEDGDLASIHNVEEYSFVISQLGYQPDDE
LWIGLNDLKVQMYFEWSDGTPVTYAKWLRGEPTHANNRQEDCVVMKGKDGFWADHSCEKK
IGYICKRKPLSEAPTEEETIDMGCQRGWKRHGFYCYFIGSTFVTFSQANQTCERHQAYLA
TVLDRYEQAYLTSLVGLKTERYFWIGLSDVEEKGTFKWANGEYVLFTHWNSEMPGRKPGC
VAMRTGTAGGLWDVIKCEEKAKFLCKMWAEGVTPPPVPTTTPVPSCPEGWDSNNRISFCF
KPFSKGEQKKTWLESQEFCRTIGGDLASISGKDEQYVIWRSIANNGFYHQHFWMGLYYLN
PDDGFAWSDGSPVRYENWGFGEPNNYQGIELCAEISGDSSMLWNDRHCDYLYGWICQIRK
GASLKPEPTESPVPKYVTTGDGWIINEDRHYYFSTESVPMEKGREFCKKNFGDLVVIDSE
TERKFLWRYILKNGKEDAYFIGLQLSVDQRTSWMDGTPVNYLAWAPHEPNFANNDENCVV
MYKNLGFWNDINCGYPNPYICERHNSSINSTVPPTTFSTPRGCNPTWLSFQNKCYKIFGS
TEDERVTWHAARTACMNLGGNLATIPNEQVQALAFLTFHMKDFLTDTWIGLNDINHELNF
LWTDGTGVYFTNWAKGFPSGHLGSYSYNGQADCVVMRNNPVKEAGKWADESCDNNRGYIC
QIKYTDAEFLPSTTTDPTSIIRYGNSSYLFIRTKMNWEDARENCKRDQFDLSSILDPYSH
SFLWLKILKYGVPIWIGLNSNVTNGRYEWIDNWRMKYTKWAEGEPKQKIGCVYLDISGAW
KTGSCNESYFSVCKKPDVQAPTEPPQLPGKCPESEGHHAWIPFRGHCYYVESSSTRNWAQ
ASLECLRLGASLVSVEDSAEASFLTYIIEPLEGKTSTFWTGMYRNVDGEWLWLDNTAVNF
VNWNTGEPSPQQNEHCVEMYANSGYWNNIYCTSYKGYVCKKPKRIDLIVCRAEMPTKAMT
KDEEATTLSHGKTGIVVIVVIIILAGSSLAGYLFYKRRKNRLSTNDSFENNLYFNSDGTG
DTKDLVTNIERNEHATL
Download sequence
Identical sequences ENSGALP00000014047 ENSGALP00000014047 9031.ENSGALP00000014047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]