SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014273 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014273
Domain Number 1 Region: 697-996
Classification Level Classification E-value
Superfamily BEACH domain 7.06e-127
Family BEACH domain 0.0000000101
Further Details:      
 
Domain Number 2 Region: 1116-1390
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.8e-32
Family WD40-repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 599-695
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-27
Family PreBEACH PH-like domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014273   Gene: ENSGALG00000008786   Transcript: ENSGALT00000014289
Sequence length 1406
Comment pep:known chromosome:WASHUC2:7:14780765:14806915:-1 gene:ENSGALG00000008786 transcript:ENSGALT00000014289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REEEKKSPAEELQKYHTDKMEGDKSDTFVSVNGLFDQWSLEDNKSLDVPAHFSAMPLEDA
STAEMSFKSEDREELWHSNPSHLSLDLSSVDSYELADVVNQMTDSLPSTPSPVENRKPFS
GQPEKELDVISDVGFSAADLSLFENQGGGDNELIQLLTDILLCVMWKGIEKSDDEAWMER
GQVFSALTKLGISNELLRPSDEIKLKLLEKMLEWSVTDNRDSKALPTHTENAFRLLLIVQ
DFLQAEGLVNSNLWTEKLLEELVILMDSLSVWYSAGPEATWFSQVQIQLLLGFIAKDNLQ
VCAMAAAKLNTLLQTKVIESQPEACYLLGKLEGILSRSIEEKTETYSFLIPLVRTLVSKI
YELLFMNLHLPSLPSTNGSPSFFEDFQEYCRSDEWKVYIDKYIIPNMKHYEENSFRHGHE
QMALYWKDCYEAFMVNMHKRDRERGESKLKFQEHFVEPFSRKARQENLRYNSMLKQLNSQ
HTATLRQWRAAQLYLLSERGPWSEMKQHPVHWKLSNVENFSRMRLKLVQNYNFNSHQDAS
DLRDNLGVYQAQPSSESLLLEVVKQVKVSDLEDDVLELPEEDTAASSNMDEKDEQSQKEK
LILSENCELITVIDVIPGRLEVTTQHLYFFDGSVEKEEGVGFDFKWHLSQIREIHLRRYN
LRRSALEIFLTDQTNYFLNFNKEVRNKVYSRILSLRSPNISGTRSPQELFKASGLMQKWV
NREISNFDYLIQLNTMAGRTYNDLAQYPVFPWILRDYTSEELDLNNPAVFRDLSKPIGVV
NEKNAKAVKEKYDNFEDPLGVIDKFHYGTHYSNAAGVMHYLIRVEPFTTLHIQLQSGRFD
CADRQFHSIPATWQALMDNPNDVKELIPEFFYFPEFLENQNGFNLGQLQISKEAVNDVVL
PKWAHSPEDFIYKHRKALESEYVSAHLHEWIDLIFGYKQRGPAAVEALNVFYYCTYEGAV
DLDALTDEKERKALEGMINNFGQTPCQLLKEPHPQRLSAEEVVQRLTRSDTSTLNLFQHL
TELKSFFIEGISDGVPIVKAVVPRNQSRSFMSQGSPEILVTASLNCIIGTHGWLPYDKNI
SNYFTFIKDTTVTNPKTQRNMSGPFAPGLEITSKLFAVSHDAKLLFSGGHWDNSIRVTSL
TKGKLIGQHIRHMDIVTCLAIDYCGIHLISGSRDTTCMIWQIVQQGGAPVGLTPKPLQIL
YGHTDEVTSVGISTELDMAVSGSRDGTVIIRTIRKGQYMRTLRPPCESSLLLTVPHLAVS
WEGHIVVHTSIEGKTTLKDKNALHLYSVNGKHLGSETLKEEVSDMCVTGEYIVMGSLQGF
LSIRDLYSLNLSISPLAMRLPIHCISVTKEYSHILVGLEDGKLIIVGVGKPAEMRSGQLS
RKLWGSSKRLSQISSGETEYNTQDSK
Download sequence
Identical sequences ENSGALP00000014273 9031.ENSGALP00000014273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]