SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014887 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014887
Domain Number 1 Region: 299-420,447-609
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.96e-39
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 711-880
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 93-215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-21
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 1017-1063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000222
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014887   Gene: ENSGALG00000009152   Transcript: ENSGALT00000014903
Sequence length 1242
Comment pep:known chromosome:WASHUC2:6:29614224:29783956:1 gene:ENSGALG00000009152 transcript:ENSGALT00000014903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPAGSAEPGSALSRAGAAPPPLGAWRPFPSACCCCFSALLDVNSWLLFYGFLYLALYAQ
VSQSKSCDKISCFSGHCVNSTCVCDQGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKT
KCTWLIEGYPNAILRLRFNHFATECSWDHMYVYDGDSIYAPLIAVFSGLIVPEVRGNETV
PEVVTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSEHGKCTTSLSIPSRVYCECDK
YWKGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVK
PFSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVVPVSKGPLQRYG
HTLALYQEDIYMYGGKIETNNGNVTDELWIFNIHSQAWSIRTPAVLVHGQQYAVEGHSAH
IVELDSRDVVMIIIFGYSAIYGYTSIVQEYYIRSNSWLVPETKGAIVQGGYGHTSVYDEL
TKSVYVHGGYKALPGNKYGLVDDLYKYEVNTRTWTILKESGFARYLHSAVLINGAMLIFG
GNTHNDTSLSNGAKCFSADFLAYDIACDEWKILPKPNLHRDVNRFGHTAVVSNGSMYIFG
GFSSVLLNDILVYKPPNCEAFRDEELCKNARPGIRCLWNKKHCESWESGNANNILRAKCP
KKTAAADDRCYRYADCASCTANTNGCQWCDDKKCISANSNCSMSVKNYTKCHVRNEQICN
KLTSCKSCSLHLNCQWDQRQQECQALPAHLCGEGWSHIGDACLRINSSRESYDNAKLYCY
NLSGNLASLTTSKEVEFVLDEIQKYTLQKISPWVGLRKINISYWGWDDMSPFTNTTLQWL
PGEPNDSGFCAYLERAEVAGLKANPCTAMADGLVCEKPVVSPNQNARPCKKPCSLRTSCS
NCTSNGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPG
CGWCNDPSNTGKGQCLEGSSRGPMKPVGMHSAEMVLDATLCPKEKSYEWSFIQCPACQCN
GHSTCINSNVCDQCKNLTTGKQCETCMPGYYGDPTNGGQCTACTCSGHANICHMQTGKCF
CTTKGIKGDQCQLCDSENRYLGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANP
EQSNKNLDISINASNNFNLNITWSIGSTAGTISGEEIPVVSKANIKEYRDSFSCEKFNFR
SNPNITFYVYVSNFSWPIKIQIVSFKSEVNIIEHILIFVIYL
Download sequence
Identical sequences 9031.ENSGALP00000014887 ENSGALP00000014887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]