SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015434 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015434
Domain Number 1 Region: 290-387
Classification Level Classification E-value
Superfamily Immunoglobulin 3.77e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 462-747
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 1.44e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 3 Region: 210-303
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000192
Family V set domains (antibody variable domain-like) 0.091
Further Details:      
 
Domain Number 4 Region: 37-89
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000194
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 5 Region: 120-202
Classification Level Classification E-value
Superfamily EF-hand 0.000000000121
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015434   Gene: ENSGALG00000009489   Transcript: ENSGALT00000015450
Sequence length 809
Comment pep:known chromosome:WASHUC2:4:23886964:24055876:-1 gene:ENSGALG00000009489 transcript:ENSGALT00000015450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDSESSDFTGYMDQDGHFKSCENKYCGLGRHCVMNGESGQAECVCMERCKPHYKPVCGSD
GEFYENHCEVHRAACLKKQKVAIVHNEDCFFKGDKCKPTEYSKVKNMLLDLQNQRYAAQS
KNRNVGEKMALRKLLVDQMFHYFDSDSNGLVDTNELSQVIKRDELGKDLSDCSLFDLLKY
DDYNSDKHLGLEEFYRAFQIVQLSLPDDQKLSTTAATVGQSAVLSCAIQGALRPPIIWRR
NNVILNNLDLEDINDFGDDGSLYITKVTTTHMGNYTCYADGYDKLYQTHILEVNVPPVIR
VYPESQAREPGVTASLRCHAEGIPNPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVR
YEDTGAYTCIAKNEAGVDEDISSLFVEDSARKTLANILWREQGTNIIFSYYSVLQDLLKD
IQSMESKNYMFYLQRHIEVSHKPNLEMQDEVCPKTDGDSVQRCVWATAVNVKDKFIYVTQ
PTLDRVLIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVQSWGNMEKNSPTLQVITQAS
GSISHHTIHTQPVGKQFDRVDDFFIPATTLIITHIRFGFILHKDEPVLQKIDLETMSYIK
TISLKDYNCIPQSLAYTHLGGFFFIYCKPDTTGAVLPQLIVDSVTDSVIGYNGDVTGRPH
VSPDGHYLVSIDDAKGLMRIQTITMRGEILDAFDIHTNLHISDVAFQPSFTEAHQYNIYC
SSSTQTDVLFVELSSGKVKMVKSLKEPVRAGEWPWNSKNRLIKDSGLFGQYLMTPSKESL
FILDGRLNKLNCEITEVERGNTVIWVGEA
Download sequence
Identical sequences 9031.ENSGALP00000015434 NYSGRC-IgSF-Q8N475 ENSGALP00000015434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]