SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015691 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015691
Domain Number 1 Region: 152-434
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-77
Family Nuclear receptor ligand-binding domain 0.00000000163
Further Details:      
 
Domain Number 2 Region: 102-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.35e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015691   Gene: ENSGALG00000009645   Transcript: ENSGALT00000015707
Sequence length 435
Comment pep:known chromosome:WASHUC2:3:21349821:21466402:1 gene:ENSGALG00000009645 transcript:ENSGALT00000015707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKDRHIDSSCSSYIKTEPSSPASLTDSINHHSPGGSSDASGSYSSTMNGHQNGLDSPP
LYPSATGLGGNGPVRKRYDDCSSTIAEDSQTKCEYMLNSMPKRLCLVCGDIASGYHYGVA
SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV
RGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIK
ALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDE
LVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIE
DVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGK
VPMHKLFLEMLEAKV
Download sequence
Identical sequences A0A2I0M533 G1NAZ5 Q5UKY7
9031.ENSGALP00000015691 ENSGALP00000015691 NP_001007082.1.86415 XP_005238782.1.75256 XP_005416210.1.5688 XP_005441966.1.10750 XP_005483068.1.73095 XP_005510098.1.63277 XP_005523386.1.90289 XP_005523387.1.90289 XP_008494795.1.100939 XP_008628559.1.15636 XP_008940649.1.37566 XP_009094645.1.15306 XP_009275114.1.47732 XP_009275115.1.47732 XP_009275116.1.47732 XP_009328477.1.49731 XP_009328478.1.49731 XP_009471221.1.38621 XP_009565480.1.62272 XP_009645132.1.23211 XP_009667296.1.43253 XP_009667297.1.43253 XP_009667298.1.43253 XP_009892620.1.48241 XP_009898381.1.92783 XP_009914396.1.2804 XP_009972558.1.75343 XP_009993042.1.85724 XP_010133213.1.100080 XP_010391889.1.2935 XP_010560436.1.12557 XP_010705002.1.16129 XP_010705003.1.16129 XP_010705004.1.16129 XP_010705006.1.16129 XP_010705007.1.16129 XP_011594097.1.59079 XP_011594098.1.59079 XP_011594099.1.59079 XP_011594100.1.59079 XP_011594101.1.59079 XP_012427821.1.42559 XP_013805307.1.3284 XP_014108383.1.90289 XP_014108384.1.90289 XP_014108385.1.90289 XP_014108386.1.90289 XP_014108387.1.90289 XP_014119842.1.73095 XP_014119845.1.73095 XP_014119846.1.73095 XP_014119848.1.73095 XP_014732351.1.99236 XP_014732352.1.99236 XP_014732353.1.99236 XP_014732354.1.99236 XP_014732355.1.99236 XP_014732356.1.99236 XP_014732357.1.99236 XP_014732358.1.99236 XP_014806224.1.91963 XP_014806228.1.91963 XP_014806229.1.91963 XP_014806230.1.91963 XP_014806231.1.91963 XP_014806232.1.91963 XP_014806233.1.91963 XP_015476491.1.82291 XP_015476492.1.82291 XP_015476496.1.82291 XP_015476497.1.82291 XP_015476499.1.82291 XP_015476500.1.82291 XP_015476501.1.82291 XP_015712678.1.68032 XP_015712679.1.68032 XP_015712680.1.68032 XP_015712681.1.68032 XP_016152710.1.66865 XP_016152713.1.66865 XP_016152714.1.66865 XP_016152715.1.66865 XP_016152716.1.66865 XP_016152717.1.66865 XP_016152718.1.66865 XP_016152719.1.66865 XP_017585527.1.15636 XP_017585529.1.15636 XP_017668292.1.3805 XP_017668293.1.3805 XP_017668294.1.3805 XP_017668295.1.3805 XP_017668296.1.3805 XP_017668297.1.3805 XP_017668299.1.3805 XP_017668300.1.3805 XP_017940554.1.51550 XP_017940555.1.51550 XP_017940556.1.51550 XP_018776811.1.15306 XP_018776812.1.15306 XP_018776813.1.15306 XP_018776814.1.15306 XP_018776815.1.15306 XP_018776816.1.15306 XP_019137925.1.2935 XP_019137926.1.2935 XP_021248834.1.32913 XP_021248835.1.32913 XP_021248836.1.32913 XP_021248837.1.32913 XP_021403240.1.53032 XP_021403241.1.53032 XP_021403242.1.53032 XP_021403243.1.53032 XP_021403244.1.53032 XP_021403245.1.53032 ENSMGAP00000009741 ENSGALP00000015691 ENSMGAP00000009741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]