SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016158 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016158
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.83e-52
Family APC10-like 0.0000000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016158   Gene: ENSGALG00000009950   Transcript: ENSGALT00000016177
Sequence length 185
Comment pep:known chromosome:WASHUC2:4:32097860:32132648:-1 gene:ENSGALG00000009950 transcript:ENSGALT00000016177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEVRQLELVEPSGWI
HVPLTDTHKKPIRTFMIQIAVLANHQNGRDTHMRQIKVYTPVEESSIGKFPRCTTIDFMM
YRSIR
Download sequence
Identical sequences Q5ZL04
ENSGALP00000041606 NP_001008467.1.86415 XP_015131660.1.86415 XP_015131661.1.86415 9031.ENSGALP00000016158 ENSGALP00000016158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]