SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016473 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016473
Domain Number 1 Region: 923-1120
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-39
Family Laminin G-like module 0.00064
Further Details:      
 
Domain Number 2 Region: 684-866
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.72e-36
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 3 Region: 244-333
Classification Level Classification E-value
Superfamily Immunoglobulin 4.61e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 523-608
Classification Level Classification E-value
Superfamily Immunoglobulin 9.48e-19
Family I set domains 0.021
Further Details:      
 
Domain Number 5 Region: 325-417
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 595-687
Classification Level Classification E-value
Superfamily Immunoglobulin 7.36e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 137-236
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-17
Family I set domains 0.035
Further Details:      
 
Domain Number 8 Region: 56-151
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-16
Family I set domains 0.05
Further Details:      
 
Domain Number 9 Region: 431-515
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000109
Family I set domains 0.0067
Further Details:      
 
Domain Number 10 Region: 1120-1164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000216
Family EGF-type module 0.019
Further Details:      
 
Domain Number 11 Region: 861-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000283
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 1161-1194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000299
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000016473
Domain Number - Region: 9-44
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000127
Family I set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016473   Gene: ENSGALG00000010143   Transcript: ENSGALT00000016492
Sequence length 1213
Comment pep:known chromosome:WASHUC2:21:6705505:6714388:1 gene:ENSGALG00000010143 transcript:ENSGALT00000016492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PATPQMSGSRLRLSQLSVADSGEYVCRADLGSTSREATVVVTVTSRDSSSYRLQSPIISI
DPHSMAVAPGEDATFKCRIHDGAQPINVTWRMGPGQHLQDNVKISANGSVISITGAHVGN
QGAYHCVASNRFGVASSVVNLLVQGAPTVSVMPPGPVTVKEGKSLSLECLGRGEPRPLVR
WSRLGSRQKVEHQTLLHMDSQAVLQLSPAKPEHAGTYICTAQSALGSAQARVDVSVETAQ
RHPGAPRVTAPPTVTVVAGDTATLHCSATGEPEPRIEWSKLRAPLPWQHRVVNGTLVIPR
AAQQDSGQYICNASSPAGFTEVFVTLDVETPPYATSLPEDSAVRAGDTVQLQCLAHGTPP
LLYTWDKLNGSLSPRAVPRAGLLRISPALPSDAGTYRCMVTNRVGRAETFARVTVHGDGG
GDSGGPLAVRVTPGSLVRGVGSTAEFACTASDPRVHLEWLKDGGELPPRHSVQDGVLRIA
ELAQGAQGVYVCRASTLHGQVEDRATLTVQALPRALINIRTAVQTVLAGMEVELECLGLG
EPQPHVTWSKVGGRIRPGVLVRAGTLTIERVERADAGQYRCTATNSVGTVQSHVILHVQA
APHIAGQPEVKEVSVGSAAVLPCLASGFPVPEISWSKLEGELPEGTRVEGTALMLPAVRL
EDAGVYACAASNRRGQETAFYVLKVQERLVPYFTQTPRSFLPLPTIKDAYKTFEIQITFR
PDAADGMLLYNGQRKSSGADFISFGLVGGRPEFRFDAGSGMATIRDPTPLRLGQYHTVRL
FRNLTRGSLQVDGQPPVNGTSQGKFQGLDLNEELYLGGYPDYTIVAKTGLSRGFVGCVRQ
LRIQNEEVAFGELDLQAHGVSNCPTCQDQPCQNGGICEDAESSTYICRCPQGFTGSNCEY
SQALHCHPEACGPDATCISRPDGHGYSCRCHLGKMGERCTEGEAVSVPSFDEAGAFISYP
PLTNVHHELRVEAEFLPRAPDGLLLFSAGKASPVEDFVALAMVSGHLEFHYELGSGTAVL
RSVEPVALGRWHRVTAERVHKDGTMTVDGGAPVQRSSPGKSQGLNLRSPLYLGGVEPPLR
PPTNASFQGCIGEVSINGKKVDLSYSFLRSRGVGQCGQSSPCLHAPCLHGGRCLPLPASS
PPFRCLCTPGFSGPRCERAADRCLEHNPCLHGGTCKDNGCICPKGYAGPYCQHGAALSEL
DQDWQEGSGGSGT
Download sequence
Identical sequences ENSGALP00000016473 9031.ENSGALP00000016473 NYSGRC-IgSF-Q6KDZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]