SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000016671 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000016671
Domain Number 1 Region: 1237-1302
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.72e-21
Family TB module/8-cys domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 488-556
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.88e-20
Family TB module/8-cys domain 0.00047
Further Details:      
 
Domain Number 3 Region: 1410-1469
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.71e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 4 Region: 719-835
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000722
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 801-916
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 372-438
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000549
Family TB module/8-cys domain 0.0041
Further Details:      
 
Domain Number 7 Region: 1552-1648
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000612
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 8 Region: 1052-1171
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000165
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 9 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 956-1048
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 11 Region: 1351-1399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000451
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 12 Region: 673-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000837
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 1310-1357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000034
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1165-1203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000194
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 15 Region: 25-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000016671
Domain Number - Region: 230-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000599
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000016671   Gene: ENSGALG00000010258   Transcript: ENSGALT00000016690
Sequence length 1650
Comment pep:known chromosome:WASHUC2:5:40339397:40394000:-1 gene:ENSGALG00000010258 transcript:ENSGALT00000016690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVCGRQCCSGWAVAPGTNHCIKPVCDPPCQNKGSCSRPHVCTCRSGFQGSRCEEVVPEQE
YHPPSIALQPPAGSLRRRTGTAERDASPREAQAPVPRHAPTRPQSPPGDFESGRIGSPVS
TQHTGPSRTVRRYPASNGQLTSNTLPNGHGHEQGSSGPNAAFQEHTLAARGANLTEKIRK
IKIIFTPTICKQTCRNGRCYNSCEKGDTTTLYSQGGHDHDPKSGFRIYFCQIPCLNGGRC
VGRDECWCPSNSTGKFCHLPAPSPEKKQGGKAPNTVASGSMKHSTYTLPLSNQLASLNPS
LVNVHINHPPEATVQIHQVARVRGDSEVSEENSVEAVLVPQMAAVPWYTYSNGNGNSIAT
EGGQQQRPPGLLGRCFREALHGQCTNPLPGLTLLEDCCGSVGLFWGVDRCLACPPRPAHP
VIENGQVECPQGYKRLNRSHCQDINECLMQGLCKDAKCLNTRGSFRCTCRPGTMLDPSRS
HCISDKAVSMEQGLCYRSAAGGVCSFPLSHRITQQICCCSRVGKGWGKNCEECPVPGSGA
FKEICPAGHGYTYSSSDIRLSMRKAEAEELPLSLEEHSESSNWTLDWAARRQRLQDSLHG
SVLEALPHPDISAGEDTSSAWHGQGWMMEGSRDAGTVPLQRATLVLQGPSSHLTPGYVIP
ALLSYPSWEASGCASSSLACGAGVCVLTPDGYSCSCHLGYTLHPSRLHCVDEDECLQDPC
TGKGHCVNSVGSYSCLCYSGYTLVFLESKQTCQDRDECEQPSTCPGQRCVNTPGSYRCEC
KEGFAMGLRGQCEDINECVDPSPCPHGKCVNTPGSYRCVGCADGYQPRNGRCIDVDECLV
ERTCAHGQCINLDGSFRCSCYRGYEVAPDGKSCEDIDECTAQAACPSRLCLNTEGSYSCM
ACDAGYTVSRDGSTCEGIPLPGTEKRVSEGRSTQSAGSMGAASGCHLGQQEGDFPHSACS
DVDECADLAIQCLGGACRNTLGSYECHCQAGFELINGTVCQDVNECLNSEICSPNGECLN
SHGSYFCICAPGFSSSDGGVNCQDVDECTDKSRCSQGQCLNTEGSYRCLCENGFKHSQET
DDCIDVDECKEYGDAICGTWRCQNSLGSYRCIMGCQPGFHWTPPGDCIDIDECANETLCG
SHGFCENSDGSFRCLCDRGYESSPSGHYCVDVNECELMVAVCGTALCENVEGSFLCLCPS
DHEEYDTEAGQCRPRAAVGEKQLEGPERHTAQPSDSMERKQCYYHISDVRLCDSVLAKNV
TKQECCCTVGAAWGDNCETYPCPILGTVEYQEICPLGKGYVPQEDPLSGKVSFTDMDECE
TFGSEFCRNGQCLNTVPGYKCFCRTGYFYDVGRLECVDQDECQNEVYCINGECLNTVGSY
HCFCSLPLVLDATGNRCVNLSGRADALEEYEIHLDVCWQTVSDYICQDLLHGEQTTYTEC
CCRLGEAWGQNCALCPHRSSADFAFLCNGASEDSDRGAEVRERPRYEYGPGLEDPHYGLP
SPDMGPYYNYLESEYGNPDVAFPRRELSSEFRGSPFHHGPGRPPPRYLPSQPGLYEGFEG
LQAEECGILNGCENGRCVRVPEGYTCDCFDGYQLDMTLMACVDINECEDVDVPVPLCQGG
TCENTEGSYRCRCLPGYVALAQPHHCVPQT
Download sequence
Identical sequences ENSGALP00000016671 9031.ENSGALP00000016671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]