SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000018906 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000018906
Domain Number 1 Region: 247-472
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-64
Family Nuclear receptor ligand-binding domain 0.00000000489
Further Details:      
 
Domain Number 2 Region: 126-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-27
Family Nuclear receptor 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000018906   Gene: ENSGALG00000011594   Transcript: ENSGALT00000018929
Sequence length 473
Comment pep:known chromosome:WASHUC2:1:49206988:49239779:1 gene:ENSGALG00000011594 transcript:ENSGALT00000018929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEMNLIGHPQLATADGFSLAEGPHLFGILSEPMSSPVQEADVSPYTQYNSVPFPQVQP
QISSPPYYSNLGFYPPQHEEWYSPGMYELRRIPSETFFTRETEIMDIPAAKKPRLGHSTG
RMKGEELCVVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCEMDMYMRRKC
QECRLRKCKQMGMLAECLLTEIQCKSKRLRKNVKQLPDQTVNEDNEGHDMKQVTSTTKMY
REKVEFTPEQQNLLDYIMDSYSKQQIPQEVSKKLLHEEFSAEGNFLILTEMATSHVQVLV
EFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFSRKLPTGHTVLLEERIRNSGISD
EFITPMFNFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDRESVERLQEPLLDILQKFC
KLHHPDNPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Download sequence
Identical sequences Q8JHU2
ENSGALP00000018906 NP_989444.1.86415 9031.ENSGALP00000018906 ENSGALP00000018906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]