SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000019094 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000019094
Domain Number 1 Region: 418-548
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000113
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 354-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000195
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 3 Region: 609-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000174
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 318-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000672
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 644-684
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000783
Family EGF-type module 0.009
Further Details:      
 
Domain Number 6 Region: 727-837
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000173
Family Growth factor receptor domain 0.0081
Further Details:      
 
Domain Number 7 Region: 277-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000155
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 687-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000127
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 843-892
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000481
Family Fibronectin type I module 0.069
Further Details:      
 
Domain Number 10 Region: 572-613
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000916
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000019094
Domain Number - Region: 394-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0691
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000019094   Gene: ENSGALG00000011696   Transcript: ENSGALT00000019118
Sequence length 1211
Comment pep:known chromosome:WASHUC2:5:54641798:54703702:-1 gene:ENSGALG00000011696 transcript:ENSGALT00000019118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSRGTGYFELQLNSVRNVNGELLNGECCDGERNPPDRDCGRDECDTYVKVCLKEYQAKIS
PGGPCSYGSGSPPVLGGNILYLNGDKYPPRGRSPETGRIVIPFQYAWPRSFTLILEAWDW
DNDTKSGEDLLIERVAHAGMINPEDRWKTLQFNGPVANFEVQIRVKCDENYYSALCNKFC
GPRDDFVGHYTCDQNGNKACMECWMGEECKQAVCKQGCNLLHGGCSVPGECKCHYGWQGQ
YCDECVRYPGCAHGSCNEPWQCNCETNWGGLLCNKDLNYCGNHHPCLNGGTCMNTEPDEY
RCACPDGYSGKNCEIAEHACVSNPCANGGTCHEISSSFKCHCPSGWSGPTCAIDIDECAS
NPCAQGGTCIDHINSFECICPQQWIGATCQLDANECEGKPCVNAYSCKNLIGGYYCDCIP
GWKGVNCHININDCHGQCQHGGTCKDEVNDYHCICPRGFTGKNCEIETNECESNPCQNGG
RCKDLVNGFTCLCAQGFSGVFCEMDIDFCEPNPCQNGAKCYDLGGDYYCACPDDYDGKNC
SHLKDHCKNNSCKVIDSCTIEVFSNTTQEGIRFISSNVCGPHGRCISQPGGNFTCACDRG
FTGIYCHENINDCLGKPCKNGGTCIDEVDSFKCFCSSGWEGELCDTNFNDCSPNPCHNGG
RCIDLVNDFYCECKNDWKGKTCHSREYQCDANTCSNGGTCYDDGDTFRCSCPPEWIGSTC
NIAKNSSCIPNPCMNGGTCVGSGDSFSCICKEGWEGRTCTQNTNDCNPHPCYNGGICVDG
VNWFRCECAPGFAGPDCRINIDECQSSPCGYGATCIDEINGYRCTCPPGRVGPRCQEVIG
IGKPCWLKGMTFPHGSRWDQECNSCHCLDGRIDCTKVWCGKKPCLLHKHWDNSNYQCPMG
QECQEKYMKCFQPPCTEWGECSASEPLPANIKCLPNSGYLDNDCARITLIFNGNKVPQGT
TTESICSEIRYLPATRSVSRDRTLIILCDLSYSTENAVEVAISFVPHRDEQDNSLIQNAA
NIIVNAITKRQNSTVMLAVTEVKVETIVVGNSSSDYLVPILCAVFSVVWLTCIIICVWWT
RKRRKERERSHPPREEGANNQWAPLNPIRNPIDRSYSNKDIRYECKNFISPQKRTCDAVE
EYVEYEEEEDEEEERDEEMDKFLSHKLTKPLPTKASDASESSPVKKSLQIGKMDNRSVKN
VNASNFEGSRD
Download sequence
Identical sequences ENSGALP00000019094 9031.ENSGALP00000019094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]