SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022048 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000022048
Domain Number 1 Region: 341-606
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-57
Family Nuclear receptor ligand-binding domain 0.0000000378
Further Details:      
 
Domain Number 2 Region: 269-346
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.91e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022048   Gene: ENSGALG00000013568   Transcript: ENSGALT00000022087
Sequence length 609
Comment pep:known chromosome:WASHUC2:2:91687780:91708335:-1 gene:ENSGALG00000013568 transcript:ENSGALT00000022087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPSPPGSSYAAQTYAYGSEYSSEIMNPDYGKLSMELSGTEITATATTSLPSF
STFMEGYSGSYELKPSCLYQMQSASSGQRPLIKMEDARLSTYQPSLPPSVDESMPSTSMY
FKQSPPSTPTTPGFPPHQSLWDEPPLPPTQTCLPPGHLMEAAPMKTAPPRFPLFHFKHSP
PHTPPAGPHMCYDPASLSLPLGSDRPPAGQAPMESHSYGLPLAKRPATLAFSPLGLNTAA
SGLMGEASGGGGGGLPSPPSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQK
NAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPL
QQEPSQPSPPSPPISMMNALVRALTDSTPRELDYSRYCSTDQAAAGTDAEHVQQFYNLLT
ASIDISRGWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSDTAEDKFVFCNGLVLH
RLQCLRGFGEWLDSIKDFSLNLKSLNLDIPALASLSALTMITERHGLKEPKKVEELCNKI
TSSLKDHLTFSCQNKGQPLESAEPKVLGVLADLRSLCTLGLQRIFYLKLEDLVPAPSIID
RLFLDTLPF
Download sequence
Identical sequences E1BYS2
9031.ENSGALP00000022048 XP_015137892.1.86415 XP_015137893.1.86415 XP_419081.3.86415 ENSGALP00000022048 ENSGALP00000022048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]