SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022061 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000022061
Domain Number 1 Region: 3818-4014
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-39
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 2 Region: 3332-3443
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-32
Family Cadherin 0.00084
Further Details:      
 
Domain Number 3 Region: 1128-1256
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 3121-3224
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-29
Family Cadherin 0.00047
Further Details:      
 
Domain Number 5 Region: 3225-3330
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-29
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 2278-2384
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-29
Family Cadherin 0.00082
Further Details:      
 
Domain Number 7 Region: 916-1035
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 2805-2913
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-27
Family Cadherin 0.00065
Further Details:      
 
Domain Number 9 Region: 1558-1660
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 10 Region: 3019-3127
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-26
Family Cadherin 0.00094
Further Details:      
 
Domain Number 11 Region: 1761-1881
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 12 Region: 817-921
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-25
Family Cadherin 0.0007
Further Details:      
 
Domain Number 13 Region: 1032-1133
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-25
Family Cadherin 0.00083
Further Details:      
 
Domain Number 14 Region: 138-260
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 15 Region: 3436-3540
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 16 Region: 2071-2178
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-23
Family Cadherin 0.0024
Further Details:      
 
Domain Number 17 Region: 457-558
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-23
Family Cadherin 0.00072
Further Details:      
 
Domain Number 18 Region: 1446-1553
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 19 Region: 2178-2285
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 20 Region: 2914-3025
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-22
Family Cadherin 0.0022
Further Details:      
 
Domain Number 21 Region: 711-815
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-22
Family Cadherin 0.0017
Further Details:      
 
Domain Number 22 Region: 2488-2598
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.0034
Further Details:      
 
Domain Number 23 Region: 1662-1783
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 24 Region: 2586-2694
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-20
Family Cadherin 0.003
Further Details:      
 
Domain Number 25 Region: 2386-2484
Classification Level Classification E-value
Superfamily Cadherin-like 4e-19
Family Cadherin 0.0019
Further Details:      
 
Domain Number 26 Region: 1874-1972
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-18
Family Cadherin 0.002
Further Details:      
 
Domain Number 27 Region: 1234-1347
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-17
Family Cadherin 0.0041
Further Details:      
 
Domain Number 28 Region: 1980-2083
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 29 Region: 1358-1458
Classification Level Classification E-value
Superfamily Cadherin-like 5.5e-16
Family Cadherin 0.006
Further Details:      
 
Domain Number 30 Region: 563-664
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000109
Family Cadherin 0.005
Further Details:      
 
Domain Number 31 Region: 2705-2803
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000003
Family Cadherin 0.0028
Further Details:      
 
Domain Number 32 Region: 4131-4168
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000376
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 33 Region: 34-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000571
Family Cadherin 0.0063
Further Details:      
 
Domain Number 34 Region: 3545-3634
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000759
Family Cadherin 0.016
Further Details:      
 
Domain Number 35 Region: 4058-4094
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000252
Family EGF-type module 0.021
Further Details:      
 
Domain Number 36 Region: 4097-4136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000143
Family EGF-type module 0.012
Further Details:      
 
Domain Number 37 Region: 367-454
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000171
Family Cadherin 0.006
Further Details:      
 
Domain Number 38 Region: 4019-4058
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000499
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 39 Region: 269-353
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000186
Family Cadherin 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022061   Gene: ENSGALG00000013579   Transcript: ENSGALT00000022100
Sequence length 4592
Comment pep:known chromosome:WASHUC2:4:63523100:63617274:-1 gene:ENSGALG00000013579 transcript:ENSGALT00000022100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRYLTMLLLLMLLVQHIGNCEGNQIPHHASPMQFTQAQYNATVYENSAAKTYVGHPVKM
GIYIVNPLWDLRYKIISGDNENLFKAEEYVLGNFCFLRIRTKGGNTAILNREVKDHYMLT
VKAVEKNTNAETRTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIG
TNGEFYYSFKERTDVFAIHPTSGVVVLTGRLDYLDTKLYEMEILAVDRGLKLYGSSGISS
MAKLTVYVEQANEYAPVITAVTLTPSESDKDPTYAIVTVEDNDQGSNGEIASLNIVAGDP
LQQFRTVRSVPGGKEYRIKAVGHIDWESQPSGYNLTLQAKDKGNPPQFSSVKVVHVTSSR
FKSGPVRFEKEIYRAEISEFAPPNTPVIMVKALPSYPHLKYVFKNTPGKVKFNLNTHTGL
ITTSEPIKAQYSSHFELEVVTSDRRASAKVLIKVLGMNSNPPEFTQTAYKASFDENVPIG
TSVMRVSAKDPDEGENGYVTYSIANLNPLPFVINHFSGIISTSEDLDYELMPRVYNLRIR
ASDWGVPYRREVEVPVTIILNNLNDNIPLFEKINCEGTIPRDLGVGEQITTVSAIDADEL
QLVRYQIESGNELDLFSLNPNSGVLSLKQSLTDGPGAKMSFHSLKITATDGENFAKPLYI
NITVATGRKLVNLQCEETGVAKMLAEKLLQANKLHSRGEVEDVFFDTHSLNMHTPQFRST
LPSSIEVREDQPVGSSIILMNATDLDTGFNGKLVYVISGGNEDSSFIVDMESGMLKILSP
LDREVKDKYNLNVTVYDLGIPQKSAWHLLDIRILDANDNPPEFLQDSYFVEVSENKELDS
EIIQIEATDKDLGANGEVKYSLLTDTDKFAINAVTGVVKVVGLLDHEEQHIYFLKIEARD
QPTEEPQLFSTVILKVSIEDVNDNPPKFIPSNYHVKIREDLPEGTIITWLEAYDPDVGQS
SQVRYSLLDSGDGTFDVDKLSGAIRIVQRLDYEKKQLYNLTVRAKDKGKPISLSSTCYVE
VEVVDVNENLHPPRFSVFADKGFVKEDAPIGSSVMTVSAYDEDEGRDGEIRYSIRDGSGM
GVFRIDEEKGIIETADHLDRETTSHYWLTVYATDQGVVPLSSFIEIYIEVGDVNDNAPQT
TEPVYYPEVMENSPKDVSVIQIEAFDPDSSSSEKLTYKITSGNPQGFFSINPKTGLITTT
SRKLDREQQAEHILEVTVTDNGIPAQSTVARVIVKVLDENDNKPQFLQKFYKIRLPERGK
PERERTARREPIYRVIAADKDEGPNAEISYSIEDGDEHGKFFIEPKTGVVSSKKFSAARE
YDILSIKAVDNGRPQKSSTTRLHIEWIPKPIPPTEPIYFEEEFFSFTVMESDPVAHMIGV
IAVEPLGIPLWFDITEGGNYDSRFDVDKGTGTIIVARPLDAEQKSNYNLTVEATDGTRSI
STQVYIKVIDTNNHRPQFSASKYEVVIPEDTVPETEILQVSATDRDEKNKLIYTMQGSTD
PISLKKFRLDPGTGSLYTTEKLDHETMNQHILTVMVRDQDVPVKRNYARVIINVSDTNDH
APWFTSSSYEGRVYESAAVGSAVLQVTALDKDKGKNAEIVYSIESGNIGNSFMIDPILGM
IKIAKELDHSNQEEYNLMVKATDKGDPPMNEVTSVHIFVTVSDNASPKFTAKEYSTEISE
SASIGSFVGMVTAYSLSSVVYEIKDGNIGDVFAINPNSGVIVSQKVLDFETLPVYTLTVQ
GTNMAGLSTNATVLVHLQDENDNIPIFMQSEYTGLISESASVNSVVLTDKNVPLVIQATD
ADKESNALLVYQIVEPSVRKYFAIDSSTGAIRTLMSLDYEETNIFHFSVQVHDMGIPRLY
AEYAANVTIYVVDINDCPPVFSRELYDTSILVPTYKGVKVISVNATDADSGIFSQLIYSI
IEGNIGEKFTINPKTGDITVQNTTQLRSRYELTVRASDGRFASTASVKINVKESKVSQLK
FTQSSYSAVVQENSTEAKTIAVVTAIGNQINEPLFYHILNPDSRFKISPTSGVLSTTGIP
FDREQQESFDVVIEVTEEHKPSVVAHVVVKVTVEDVNDNAPSFVNLPYYAAVKVDSEVGY
VIRRVTAVDKDAGRNGEVHYYLKEHHEHFQIDPSGEISLKKKFEPDTVNKEYLVTVVAKD
GGEPAFSAEVIVPITVMNKAMPVFEKPFYSAEIPENIQLHSPVVHVQANSPEGLKVFYSI
TDGDPFNQFMINFNTGVINVVAPLDFESHPAYKLNIRATDSLTGAHADVFVDIIVEDIND
NAPVFTEQSYAVTLSEASVIGTPVVQVSATDADSGTNRGISYHLVEDDTESHDYFHIDSS
TGLILTTRALDYEKIQQHKLLIRAVDGGMLPLSSDTVVTVDVTDLNDNPPLFNQLVYEAK
ISELAPRGHFVTCVQASDADRSDADKLEYSILTGNDQKNFIINSKTGIITISNLRRQALK
SHYILNVSVSDGVFRSSAQVHVTVTSANMHSPVFSQNEYEVELAENAPLHTLVTVVRARD
EDSGTYGHITYHIINDFAKDRFYISERGQIFTSEKLDRETQAEKVIAISLMAKDSGGKVA
FCTVNVILTDDNDNAPQFRATEYEVNIGSDVPRGTSVIKVWASDADEGTNADITYTIEAE
SENVKENLEIDSLSGIITTKESLIGLENEFLTFFVRAVDGGSPQKESVVPVYARILPPEV
SLPKFSEPFYSYMVSEDIPVGTEIDVIKAEHNQTLVYSLIKGNTPESNRDNFFVIDRQTG
KLKLEKNLDHETTKWYQFSVLAQYTNEDYNVISSVEVSIQVKDANDNKPVLESNPYEAFI
VENMPAGTRVIQVKGTDLDSGLNGQVTYSLDPSQELDIIESFAINMETGWITTLKELDHE
MRDKYKITVVAADRGEKIQLSSLAVVEVTVTDVNDNPPRFTAEIYKGTVSEDDPPGGIIA
ILSTTDADTKEVNRQVSYYITGGDLLGQFAVENIQNEWKVYVKKPLDREEKDHYLLNITA
TDGTFATRAVVEVKVLDANDNSPVCEKALYTDTVPEDALPGKLIMQVSATDADIRSNAEI
TYTLHGPGAEKFRLTADTGELKTLMPLDREQQAVYYLLVKATDGGGRFCQANIILTLEDV
NDNAPEFTVDPYSITVFENTEPKTLLTRVQATDADAGMNRKIHYSLVNSAEGQFSIDEFS
GIIRLEKPLDRELQAVYTLTLRATDEGLPRRLSSTSNLIVSVLDINDNPPVFEYREYSAS
VSEDTVVGTEVLQIHAASRDIEANAEITYSIVSGNEHGKFSIDSTTVGAIFIIDSLDYES
SHEYYLTVEATDGGTPSLSDVVTVNINVTDINDNTPVFSQDTYTAVISEDAVLEQSVITV
MADDADGPSNNHIHYTITDGNQGNPFTIDPSRGEIKVTKLLDREKISGYTLTVQASDNGS
PPRRNTTTVNIDVSDVNDNPPVFSKGNYSIIIQENKPVGFSVLQLVVTDKDSSHNGPPFL
FTILSGNEENTFQVNHQGVLTTTAALNRKLRDHYLLHVKVTDNGKPPLSSLTYVDIRVIE
ESIYPPAILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLTYSLDPKMESMFSVSSTGG
KLIAHKRLDVGQYLLNVTVTDGKFTTAADITVHIKQITQDLLNHSITIRFANLAPEEFIG
DYWRNFQRALRNILGVRRNDIQIVSLQPSDRPSNLDVLLNIEKSGSSQHPMRILLHKINS
SVPDLEEILGVRIIDVFHKLCAGLDCPLKFCEEKVTLDENIMSTHSTARLSFVTPRHHRA
AVCLCKEGRCPVANSACEGNPCPEGTECIGDPKEGKYTCVCHDSKTGQCPASVGSAVTFS
GNSYVKYRLMENENKEEMKLTMRLRTYSAHAVVMYARGTDYSILEIHHGRLQYKFDCGSG
PGIVSVQSIQINDGQWHSVSLEVDGNYARLVLDRVHTASGTAPGTLRTLNLDNHVFFGGH
IRQQGTRHGRSPQVSNGFRGCMDSIVLNGQELPLNSKPRNYAHMEESVDVTPGCILTTTE
GCSSNPCQNGGICNALSNGGYYCKCAPLFMGTHCDVSVNPCASNPCLYGGTCIPVSDDFI
CQCRGQYAGQRCQLGPYCKDNPCKNSGKCIDSLDGPVCECEAGFRGERCLTDIDECTENP
CLNGALCENTYGSYHCNCSHGFGGKHCTDIVLNKYVSTSWNISLAEVIGIIVFIAGIFLL
VGIFVVCRKVMNRKKKHQPEPEDKQLGATTAFLQRPYFDAKLNKNIYSDVPPQVPVRPIS
YTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPDSVHGHRKAVAVCSVAPNLPPPPPSN
SPSDSDSIQKPSWDFDYDTKVVDLDPCLSKKPLDEKSSHPYSARESMSEVQSLSSFQSES
CDDNGYHWDTSDWMPSVQLPGIQEYPNYEVVEESAPLYTDPNAIDTDYYPGGYDIESDFP
PPPDDFPAPDELPPLPPEYSDQFESIQPPRDMPAVGSLGSSTRSRQRFNLNQYLPHHYPA
DMSEPQTTTSGANGNYREPYAPYTLGYNRDFEAPTVDNMSMSVYASTASCSDVSACCEME
SEVMMSDYESGDDSHFENVKIPPLDSQQHTEV
Download sequence
Identical sequences 9031.ENSGALP00000022061 ENSGALP00000022061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]