SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000022984 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000022984
Domain Number 1 Region: 206-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-79
Family Nuclear receptor ligand-binding domain 0.000000000221
Further Details:      
 
Domain Number 2 Region: 101-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-28
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000022984   Gene: ENSGALG00000022985   Transcript: ENSGALT00000023026
Sequence length 474
Comment pep:known chromosome:WASHUC2:1:73465346:73504901:1 gene:ENSGALG00000022985 transcript:ENSGALT00000023026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKMVDTENQLYPLTPLEEDDIGSPLSGEFLQDMENIQDISQSLGDDSSGALSLTEFQSLG
NGPGSDGSVITDTLSPASSPSSINFATAPGSIDESPSGALNIECRICGDKASGYHYGVHA
CEGCKGFFRRTIRLKLIYDKCDRNCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPR
SEKAKLKAEILTGENYVEDSEMADLKSLAKRIHDAYLKNFNMNKVKARVILAGKTNNNPP
FVIHDMDTLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTKLTEFAKSIPGFS
NLDLNDQVTLLKYGVYEAIFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPK
FDFAMKFNALELDDSDISLFVAAIICCGVLRIDRPGLVNVGHIEKMQESIVHVLKLHLQT
NHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAHLHPLLQEIYRDMY
Download sequence
Identical sequences 9031.ENSGALP00000022984 ENSGALP00000022984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]