SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023567 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023567
Domain Number 1 Region: 242-337
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000247
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 131-195
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023567   Gene: ENSGALG00000014652   Transcript: ENSGALT00000023613
Sequence length 619
Comment pep:known chromosome:WASHUC2:25:1588368:1596958:-1 gene:ENSGALG00000014652 transcript:ENSGALT00000023613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGGGQRDAGTAGGRRSKWDQPGPAPAFLLSGAAPLPGRPFPGGGDGGTAVGVSESSA
APSGALDAAAAVAAKINAMLMAKGKLKPAPNTADKLQALGKGPATNKSKDDLVVAEVEIN
DVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTAEEKAKVGPGDRPLYLHVQGQTREL
VDRAVNRIKEIITNGVVKAATGSSPTFNGATVTVYHQPAPITQMSPAVGQKPPFQSGMHY
VQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAF
EPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQITTAVPLAGFAQPAAINSVPS
QPSYYPSNGYQSGYPVVPPPQQPVQPPYGVPGIVPPAVPMAPGVLTTLPTGVPPVPTQYP
ISQVQPPASTGQSPLSAPFLPAAAPVKTTLPAGTQPQVQPHPQGQKRRFTEELPDERESG
LLGYQHGPIHMTNLGTGFSSQSEIDGAGSKPASSSGKERERDRQLMPPPAFPVTGMKSES
EERNGVGSLPGSHDHQAKKMKTSEKGFGLVAYAGDSSDEEEEHGGHKNASTFSQGWSLGY
QYPSSQQRAKQQMPFWMAP
Download sequence
Identical sequences Q5ZL54
NP_001026499.1.86415 ENSGALP00000023567 9031.ENSGALP00000023567 ENSGALP00000023567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]