SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000023620 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000023620
Domain Number 1 Region: 2377-2449
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-19
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 575-696
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-19
Family Growth factor receptor domain 0.0061
Further Details:      
 
Domain Number 3 Region: 991-1060
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-18
Family TB module/8-cys domain 0.00071
Further Details:      
 
Domain Number 4 Region: 2092-2162
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.75e-18
Family TB module/8-cys domain 0.0000915
Further Details:      
 
Domain Number 5 Region: 488-618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-17
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 1804-1934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.65e-17
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 7 Region: 351-417
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.53e-17
Family TB module/8-cys domain 0.0019
Further Details:      
 
Domain Number 8 Region: 1730-1825
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-17
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 9 Region: 2170-2304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 10 Region: 1358-1493
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.28e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 11 Region: 694-767
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.92e-16
Family TB module/8-cys domain 0.00084
Further Details:      
 
Domain Number 12 Region: 2492-2620
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.55e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 13 Region: 886-970
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000131
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 14 Region: 753-895
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000132
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 15 Region: 1567-1640
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000157
Family TB module/8-cys domain 0.0000456
Further Details:      
 
Domain Number 16 Region: 1449-1577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000455
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 17 Region: 1116-1240
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000942
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 18 Region: 1197-1334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000018
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 19 Region: 2262-2379
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000345
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 20 Region: 203-253,312-332
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000212
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2618-2735
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 22 Region: 1646-1701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000231
Family EGF-type module 0.00063
Further Details:      
 
Domain Number 23 Region: 2448-2497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000101
Family EGF-type module 0.005
Further Details:      
 
Domain Number 24 Region: 2053-2106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000237
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 25 Region: 1065-1112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000346
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 26 Region: 1970-2027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000436
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 27 Region: 1926-1967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000431
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 28 Region: 1690-1731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 29 Region: 1321-1358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000281
Family EGF-type module 0.01
Further Details:      
 
Domain Number 30 Region: 2015-2050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000116
Family EGF-type module 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000023620
Domain Number - Region: 174-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00485
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 251-365
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 2831-2875
Classification Level Classification E-value
Superfamily Cadherin-like 0.0479
Family Cadherin 0.015
Further Details:      
 
Domain Number - Region: 141-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0733
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000023620   Gene: ENSGALG00000014686   Transcript: ENSGALT00000023666
Sequence length 2914
Comment pep:known chromosome:WASHUC2:Z:55647616:55839268:-1 gene:ENSGALG00000014686 transcript:ENSGALT00000023666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQRWLCLQPCFLWLSCLALCAHGAAGQQKPPPRVRPAGGAGGIYPAAAVAHREEGAGS
AAAAAGRVRRRGQQEALRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSR
PNMCTCASGQISPTCGPKSTQQCSIRCMNGGTCADDRCQCQKGYIGVYCGQPVCEKGCQN
GGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCATIGRA
WGHPCEMCPAQPQPCRRGFIPNIRTGACQGTDTVQKIPSSCLQGGCYQLRPGISMICPSA
HKILDNSQKGSRIDIDECIIIPGVCEGGECSNTVGSYFCLCPRGYVSSTDGSRCIDQRAS
TCFSNLVNGRCAQELPGRFTKRQCCCESGRCWAIGSVPEMCPVRGSDEHRRLCVDGVPAG
GGSRSGGGTGGNGFLPGGNGNGYSPGGAGFIPVPGSNGFSPGVGGAGVGTGGQTPAGNGP
IITGLTILNQTIDICKHHPNLCLNGRCIPTISSYRCECNMGYKQDANGDCIDVDECTSNP
CSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQCICN
AGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDIDECQ
TSGICMNGHCINTEGSFRCECPPGLAVGVDGRVCVDTHMRSTCYGGIKKGACIRPFPGAV
TKSECCCANPDYGFGEPCHPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNGI
CENLRGSYRCNCNSGYEPEPSGRNCVDIDECSVNGLLCDNGLCRNTPGSYSCTCPKGYVF
STETDTCEDTNECESSPCVNGACRNNLGSFSCECSPGSKLDSTGLICIDSLKGTCWLNIQ
DSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVKGVTCEDVNECDVFP
GVCPNGRCVNSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIQSVPGKFRMD
ACCCAVGAAWGSDCEECPKPGTKEYEALCPRGPGFSNRGDILTGRPFYKVDINECKVFPG
MCMNGKCRNTIGSFKCRCNSGFALDMEERNCTGLVFCYLLPIYCKIDICVNTPGSFECEC
FDGYESGFMMMKNCMDIDECERNPLLCRGGMCVNTEGSFQCDCPVGHELSPSREECIDVN
ECSLSDNLCRNGNCVNMVGTYQCSCNSGYQATADRQGCVDIDECMIMNGGCDTHCTNSEG
SYECSCSDGYALMPDVRTCADIDECENNPDICDGGQCSNIPGEYRCLCYDGFMASMDMKT
CIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHA
SCVNVPGSFKCTCREGWFGNGIKCIDLDECSNGTHQCSVNAQCVNTPGSYRCACAEGFTG
DGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSKSCQDIDECSFQNICV
FGTCNNLPGMFHCICDDGYELDRSGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDF
QLNPTGVGCVDNRVGNCYLKYGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCP
PVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPKGYY
LSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYR
SYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTVIDFVLVCINVDGLISIL
VTVYNLNIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLC
QRNADCINSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDMQGSYQCICHN
GFKASQDQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCMDIDECSSFF
GQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCIDTNECVALPGSCSPGTCQNLEGSFRC
ICPPGYEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTRQ
SFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHGT
IPGIDDTREDVNECLESPGICSNGHCINTDGSFRCECPMGYNLDFTGVHCIDTDECSIGN
PCGNGTCTNVIGSFECNCHEGFEPGPMMNCEDINECAQNPLLCAFRCINTYGFYECTCPV
GYELRDDQKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMTRRPDGEGCTDENE
CRTKPGICENGRCMNVIGSYRCECNEGFLSSPSGIECLDNRQGFCFAEVLQTMCQMASSS
RNLVTKSECCCDGGRGWGNQCELCPLPGTTQYKKLCPHGPGYTTDGRDIDECKVMPNLCR
HGQCINTMGSFRCFCKVGYTTDISSTSCVDLDECSQSPKPCNFICKNSEGSYQCSCPRGY
ILQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSL
CGSKGICQNTPGSFTCECQRGFSLDSTGLNCEGKDVDECDGNHRCQHGCQNILGGYRCGC
PQGYIQHYQWNQCVDENECSNPNTCGSASCYNTLGSYKCACPSGFSYDQFSSACHDVNEC
SSAKNPCNYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYVPVDEDADEENALSP
EACYECKINGYPKKDNRRKRSLNETVRIRKIEQVSLESLDMDSPLKMRVNISRLDNKEHI
LELMPAIEPLTNHVRYIISHGNDDGVFRIHQRDGLSYLHTAKKKSVPGTYTLEITSIPLY
KKKELKKLEDSNEDSYLLGELGEALRMRLWLELY
Download sequence
Identical sequences 9031.ENSGALP00000023620 ENSGALP00000023620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]