SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024147 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024147
Domain Number 1 Region: 1578-1765
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.41e-35
Family Laminin G-like module 0.00052
Further Details:      
 
Domain Number 2 Region: 1400-1577
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.45e-33
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 3 Region: 988-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-24
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 1177-1346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.33e-21
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 5 Region: 775-970
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.82e-19
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 6 Region: 124-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.0031
Further Details:      
 
Domain Number 7 Region: 16-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 75-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000077
Family Laminin-type module 0.048
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000024147
Domain Number - Region: 268-515
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000366
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0092
Further Details:      
 
Domain Number - Region: 526-577
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 0.057
Family Bcl-2 inhibitors of programmed cell death 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024147   Gene: ENSGALG00000015001   Transcript: ENSGALT00000024193
Sequence length 1766
Comment pep:known chromosome:WASHUC2:3:68340444:68437817:1 gene:ENSGALG00000015001 transcript:ENSGALT00000024193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQEGFYRTSSGKCSPCNCNGNANRCLDGSGICVDCQRNTTGEHCEQCPDGFVGDVVGGAP
TFCQPCPCPLPEAANFAVSCYRKNGNVRCVCKENYAGPNCESCAGVPPGYYGNPLLIGST
CKKCDCSGNSDPNLIFEDCDEVTGQCRNCLHHTTGFKCEQCAPGYYGDAIFAKNCTACNC
GGRMCDSRTGECLADSPLVSTGTDCPTISCDKCIWDLTDDIRLAVLAIDESKSTLLSIST
GVAAQKRLHDLNLTTTHLQTQAAMSKKKDHSTLWTIQVDDAVDDMNDLLREAENLDDQGN
QASSKGLLVQKETMETNNRATQLVQKLSNMRDNIQEISSKMKYYAIQQELSPEEIAQKLS
VAEEMLKEIKRRKPFTNERQLADEEEHAAEDLLQRVEEFHERYNDTRSLFSDVVEQLSEH
NMKLSDLEEALGQALDYVIQTEAINKENTANLQEHEKQHEKLKEQADEVNSIVLSATAIL
AEPQKISSELSEVIKNVSGFYAEIDGAKKELQEKIANLSLFDDELEEKAMQHAHNLRRLA
DELDRNLHGVDTNGLVQRAINASNVYENIAGYIEEANKAALLALNTTNRVNDAAVGIDTQ
IIYHRGKSEELLRRAMELQQTAAYSNDLTIADTSRHVNGTAARMHAVQSKLMRAITKMQS
AELGLEARERLEQAKQKTAEAVSTTVTVTQATTPMDENVRLWSQNLQDFQHDSAAYDSAV
HSAGDAVKKLTEVFPQLLDKLRKVEQKAPANNISSSIQRIRDLIAQTRSVASKVQVSMMF
GGESAVEVNPKINVEELKSFTSMSLYIKLQKDNPQLAASPDRFILYLGNKNVKNYMGLAI
KNDNLVYTYNLGDQDVEIPLDSKPVSTWPSYFSIIKIERIGRHGKMFLTIPSLSSTSEEK
FIKTGESLGPSSLLNLEPENTVFYIGGAPPDFKLPPSLDLPGFIGCLELATLNDDVISLY
NFKHAYNIDTTTSPPCARNKLAFTQSRAVSYFFDGSGYAVARNIERRGRFSQVTRFDIEV
RTPSDNGLILLMVNGSMFFSLEMHNGFLYLRYDFGFSTGPALLEDSMKKAQINDAKFHEI
SIIYHNSKKMILVVDRRHIKSIDNERTAMPFTDIYIGGAPAEVLQSSSISSHLAGIIGFK
GCMKGFQFQKKDFNLLEEPGTLGISYGCPEDSLISRKAYFNGESFIASSQKVSLLSEFEG
GFNFRTLQPNGLLFYYSEGSDVLSISMDRGAVVLNASGIKIQSPDRNYNDGKTHFIVTSV
TPERYELSVDDKKQSKKNPVKDRAGKSPDSIKKFYFGGSPLKTQQANFTGCISNAYFTRL
DREVEVEDFQRYSEKVQTSFYGCPVESPPVALLHKKGRNSSKAKGNRNKKVGRDKDKASQ
PSTGLKKLYQEVNMQKDPQCHLPMNPKATEHAYQFGGTANSRQEFDHLPKDFSERAQFSI
SLKTHSSHGMIFYVSDQKETNFMTLFVAHGRLIFMFNAGHQKIRIKSQEKYNDGLWHNVI
FIRGKNIGRLIIDGLRVLEETFNVNANTWQVTEPLYIGGVAPGKAVKNIQINSVYSFSGC
LSNLQLNGRSITSASQTFSVTPCFEGPSEAGTYFSSEGGYVVLDESFSLGLKFEVVFEIR
PRSSSGILLHGHSVNGEYLNMHMRNGQVTVKLNNGIRDFSTSVTLKQSLCDGRWHRIAVI
RDANVVQLDVDSEVNHVVGPLNPKATDHREPVFIGGVPESLLTSSLTTRNSFIGCIRNFM
IDEKTVSFSKAALVSGAVSINTCPAA
Download sequence
Identical sequences 9031.ENSGALP00000024147 ENSGALP00000024147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]