SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000024312 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000024312
Domain Number 1 Region: 11-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-78
Family BAR domain 0.0000000029
Further Details:      
 
Domain Number 2 Region: 286-349
Classification Level Classification E-value
Superfamily SH3-domain 1.29e-22
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000024312   Gene: ENSGALG00000015096   Transcript: ENSGALT00000024358
Sequence length 353
Comment pep:known chromosome:WASHUC2:Z:32741006:32832334:1 gene:ENSGALG00000015096 transcript:ENSGALT00000024358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMAKTIEYLQP
NPASRAKLSRGDTMSKIRGQEKGPGYPQAEALLADAMLKFGRELGEECNFGPALADVGEA
MKELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKMEGRRLDFDYKKKRQGKLPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQATQILQRVTSKL
EDRIKEASSQPKREYQPKPRMSLDFTSGGDNTQHNGGISHATTPKPAGAHMDQPCCRALY
DFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVDILVPLPN
Download sequence
Identical sequences ENSGALP00000024312 9031.ENSGALP00000024312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]