SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025782 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025782
Domain Number 1 Region: 228-514
Classification Level Classification E-value
Superfamily Kelch motif 3.66e-48
Family Kelch motif 0.0061
Further Details:      
 
Domain Number 2 Region: 622-782
Classification Level Classification E-value
Superfamily C-type lectin-like 1.24e-22
Family C-type lectin domain 0.0029
Further Details:      
 
Domain Number 3 Region: 3-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-21
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 4 Region: 928-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000326
Family Laminin-type module 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025782   Gene: ENSGALG00000016034   Transcript: ENSGALT00000025829
Sequence length 1296
Comment pep:known chromosome:WASHUC2:4:92728863:92859992:1 gene:ENSGALG00000016034 transcript:ENSGALT00000025829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRLTEPSGYVTDGPGNYKYKTKCTWLIEGRPNTILRLRFNHFATECSWDHLYVYDGDSIY
APLLAAFSGLIVPEKDSNETVPEVVATSGYALLHFFSDAAYNLTGFNITYNFNMCPNNCS
GRGECRLNNSSNSLECECAKYWKGEACDIPYCTDDCGAPERGFCNFNDTKACVCSAGWQG
PGCSIPVPANRSFWTREEYSLPKLPRASHKTIIHNNKMWIVGGYVFNHSDSQKVLAYDLI
SEEWLPLNNTVNSVEMRYGHSLALHKDDIYMYGGKIDATGNVSSQLWVFNIPRQSWTQAA
PKAKEQYAVVGHSAHIVTLEDESVVMLVIFGHCPLYGYISNVQEYNLATNTWSILQTSGA
LVQGGYGHSSVYDPHTRSIYIHGGYKAFSANKYKLADDLYRYDVDSRMWTILKDSKFFRY
LHTAVIMSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDMACNTWSVLPRPGLHHDVNRF
GHSAVLYNSTMYIFGGFNSLLLSDILKYTPERCEAFANETACMHAGPGVRCVWDPARPGC
VPWEMATLQQQQKVLEDCPAKPVVDNEKCDQITDCYSCTANTNNCQWCTDQCISMHNNCT
EEQVPITAYENCPKDNPAYHCNKRTSCKSCAMDQNCQWEPRNQECIALPENICGTNWHLV
SNSCLKITNAKENYDHAKLSCRSSGASLASLTTQKKVEFVLKELQKMQSSSKALTPWVGL
RKINVSYWCWEDMSPFTNTLLQWLPDEPSDAGFCGYLAEPSSQGLKAATCINEVNGSVCE
RAGVSSPNHSAKQCRTPCALRTMCGECTSGSSECMWCSNMKQCVDSNAYVASFPYGQCME
WYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCTDGSYRGPVKVPTPSATGK
QSLEPVLNVSMCLEEHNYNWSFIQCPACQCNGHSKCINESICEKCENLTTGKHCETCISG
YYGDPTNGGTCQPCKCNGHASVCNTNTGKCFCTTKGIKGDECQLCEVENRYQGNPLKGTC
YYTLLIDYQFTFSLSQEDDRYYTAINFVATPEEQNRDLDMFINASKNFNLNITWATSFAA
GTQAGEEIPVVSRTNIKEYKDSFSNEKFDFRNNPNITFFVYVSNFTWPIKIQIAFSQHSN
FMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREMQQMASRPFASINVAL
ETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGVGGIPPPGQSASGLAVA
SALVDISQQMPIAYKEKSGAIRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSGALP00000025782 9031.ENSGALP00000025782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]