SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025915 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025915
Domain Number 1 Region: 207-291
Classification Level Classification E-value
Superfamily DEATH domain 6.6e-17
Family DEATH domain, DD 0.016
Further Details:      
 
Domain Number 2 Region: 103-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000353
Family TNF receptor-like 0.0037
Further Details:      
 
Domain Number 3 Region: 30-81
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000419
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 4 Region: 294-367
Classification Level Classification E-value
Superfamily DEATH domain 0.00000102
Family DEATH domain, DD 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025915   Gene: ENSGALG00000016114   Transcript: ENSGALT00000025962
Sequence length 402
Comment pep:known chromosome:WASHUC2:2:141817105:141835964:-1 gene:ENSGALG00000016114 transcript:ENSGALT00000025962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFLCCTLVLLDISVKWSIQDISPPKYLHYDPGTSRQVMCNQCPPGSYVKQHCTAASPT
VCAPCPDQYYAEDWNSNDECQYCSAVCKELQYIKQECTSTQDRVCECIEGWYLELEFCLK
HTECPPGFGVAQPGTPESDTVCKSCPEGFFSNETSSKAVCQKHTNCSALGFKTALKGNAV
RDNICQENTDTSPQKCGIDITLCEEAMFRFAVPTRFTPNWLNTLADNLPGTKISTENIER
IKQRHSSQEQTFQLLKLWKQQNKEQDMVKKIIQDIDHCENSVLKHLGQPNLTFEHLNTLM
ASLPGKKVGKEDIERTMKLCQHAEQVLKLLNLWRIKNGDQDTIKGLMYGLKHLKTYHFPK
RIIQSLKKVIKFLHRFAMYRLYQKLFLEMVGSQLKSVKVRCV
Download sequence
Identical sequences A0A1D5PQE4
9031.ENSGALP00000030174 ENSGALP00000025915 ENSGALP00000030174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]