SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000025977 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000025977
Domain Number 1 Region: 87-132
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000235
Family Elafin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 864-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000081
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 763-874
Classification Level Classification E-value
Superfamily SEA domain 0.0000235
Family SEA domain 0.012
Further Details:      
 
Domain Number 4 Region: 475-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000659
Family EGF-type module 0.035
Further Details:      
 
Domain Number 5 Region: 369-448
Classification Level Classification E-value
Superfamily SEA domain 0.000085
Family SEA domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000025977
Domain Number - Region: 286-353
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000232
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number - Region: 236-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0839
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000025977   Gene: ENSGALG00000016157   Transcript: ENSGALT00000026024
Sequence length 1298
Comment pep:known chromosome:WASHUC2:1:112649248:112651686:1 gene:ENSGALG00000016157 transcript:ENSGALT00000026024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERGLSLLGYHLCQYSLTKNVFKVVAYQKSFEKNTSCGGWVPWMVCPRMYYKTQYRTVEVP
ETINFTDCCEGYEQVGLYCSLALNRSSVFASRPGICPMENIETSDYSCTFDAECPGLKKC
CNSSKGAGCVNPKPEERMFWYNVTVLVKMDFNELIRVDSHLLNHSRLLHSMITGALQPLN
TSVHHIQSNYAEMYAGTVASQVLIGLHQPAPLAEVSSSLKNMVKRVYEVIDTDVKDVDEC
SYAEFNACPEQNSCVNLEGYYSCIPEHQEAYVRPLPLSTRKDGIDPSAITNHRIFSVTSN
SFEMSWHVTSTLNHTFQVQVFQDKEIVKSMKTDEEKMGVSGLEAGVMYSVEISYESCGKS
ILSHQNVKTEAKIFGITMRILNYSFTEDLHDSSSSAYEEFSRLLLTEIGNSFPPNISALY
ESGKLKVQIESLRAGSIIVRLRIAVQDPGFPVDASSFAPVLSYLYNGSVLLVDQQNSAVE
DWDECASPIDNDCSVFAHCINLMGSYLCRCKTTMDTNPSRPGRNCEGEIVSPLTERTALE
VASSTQLAPEATFAASAFPTISAGSETSTTAHSPAALSLGESPGVTGYDRHLPGSQPNAK
PGHGLHVLISCSWRPPLTQPHFCLSCATSTSPVLITAAAESTSPILLSCTAAMPVPVFFS
CLPSPSCCILCCPALARPWNRARHVTRLGAFWPKGGKIYAEPCFSILVPSEESVNMKSKA
QCRSLTVSGLEINALCTLEIRTEICREESRMVQQKVKLSAAVQKLNGMVRITNVKYSPGF
SNASSEDYQNFAQLFVDEVHKSLPLDVLQQMDAGLIKVLITDITNGSTVVSFHLLIAEDV
DIYYIITAFRDAIEHSSYFTVDKNSVSINDYDECKSEEDDCSPDASCYNTLGFYHCSCND
GFADMHPERPGRNCAVDSSGFFCLSLLADIYVTLPLLTTGSGSAPDVPPRASPAPLVKPA
QVSIKDAVTVFCEIEKTILAIQKGFLHQESISESSLYLGEPLCNVSISNGTHAVLQAGWS
ECGTEVETNVTNTVVKTVLRNDDSAQGVIHHLKVASPIHCVFQNNLLTSSGYTAEGIYTI
FEDLHGSGHFRTEMQLFIGNSPVPKNFSISASDDVLIEVGIQREDSKLKVVLTDCWATPT
NNSVDPLSFAFIKNSCPIPNTYTTLLENGNSSKAQFKLKIFSFVNNSVVYLHCKIRICME
TPGSTCRTRCHAARSLKTGEIIAAHRTSWGPLCKSAASDPKREKEPGMGVGYIILIVIAV
FGFVLAVVSLVIFQCKQKMGRYNFRIKSDNFSYQVFYD
Download sequence
Identical sequences ENSGALP00000025977 9031.ENSGALP00000035918 ENSGALP00000035918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]