SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026026 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026026
Domain Number 1 Region: 30-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000029
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 459-589
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000439
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 433-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000025
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 4 Region: 623-666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000138
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 5 Region: 314-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000091
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 199-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000237
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 585-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000262
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 8 Region: 1-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000104
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 159-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000464
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 10 Region: 352-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 11 Region: 395-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000174
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000026026
Domain Number - Region: 283-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000108
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 240-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00205
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026026   Gene: ENSGALG00000016183   Transcript: ENSGALT00000026073
Sequence length 691
Comment pep:known chromosome:WASHUC2:3:87821848:87945796:1 gene:ENSGALG00000016183 transcript:ENSGALT00000026073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEADVAACLSQPCGASSICKDMSDGYVCFCAPGFIGNNCEIEVDECLSDPCHSGATCIDH
LNGFSCICQGGFQGTTCETNINECHSSPCLHNATCADFVGGYECICLPGFTGESCTRCET
DIDECASSPCKNGATCIDQPGNYFCQCMAPFKGLNCEFRPCEASNPCENGAVCTEEMNLD
AFPLGFQCQCVKGFAGPRCEINVNECSSNPCLHGYCYDIVNGFYCLCNPGYAGLTCEQDI
DDCINNACEHNSTCVDLHLNIQRCSRLSGFQAYTCKFRLEDKPPCNSDPGCACKITRYQC
VCLPGWEGTFCEYESNECDSEPCRNNGTCTDLFNSYRCLCTAGWTGPDCSEDINECDSEP
CLNGATCYESVKQGQFVCICPPFYTGDFCHQRFSPCELPYNPCINNSTCLAQADGNPMCI
CKTGYEGTYCEVNSDECISHPCQNEGLCVDGINSYRCFCQHGFTGTLCEVEINECLSRPC
KNNGTCLDLINRFICNCAPGYYGSLCEIDINECETLPCLNGGSCINRLGGYQCFCSPGFT
GDRCETNTDECISTPCLNNGSCIDDINSYKCHCRSGFIGTNCETNVNECWPEPCLHGSKC
IDLIDGYQCSCEAGWTSSRCEININECESVPCINGGSCQDLVNEFACICLTGYTGKFCEF
DIDICNEPTVSSVLCHNGGVCVDGPGRTFHC
Download sequence
Identical sequences ENSGALP00000026026 9031.ENSGALP00000026026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]