SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000026719 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000026719
Domain Number 1 Region: 398-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-24
Family MAM domain 0.0023
Further Details:      
 
Domain Number 2 Region: 220-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000987
Family EGF-type module 0.049
Further Details:      
 
Domain Number 3 Region: 92-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 4 Region: 165-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000026719   Gene: ENSGALG00000016584   Transcript: ENSGALT00000026770
Sequence length 548
Comment pep:known chromosome:WASHUC2:1:126433335:126473646:-1 gene:ENSGALG00000016584 transcript:ENSGALT00000026770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPAPGGALLAAFLAAALAAAGSSRARGQLVTVSQPGVCRYGSRLDCCYGWKKNNKGRCE
AICGHGCKYGECMGPNKCKCYPGFTGKTCNQDLNECGLKPRPCEHRCMNTHGSYKCYCLN
GYMLMPDGTCASSRTCAIANCQYGCEEVKEEVQCLCPSVGLHLGPNGRTCIDIDECSTGR
AVCSFNRRCVNTFGSYYCKCQLGYELKYISGHYDCVDVNECVTTAHRCNLHAECLNTEGS
FKCKCNQGYQGNGFDCAAIPEKSVKEIPRIPGTAKDTIKKLLAHKNSVTKHKAIKNVIPE
AAMTPASKTRLQSLDYEGGFDLGGSYTVGEKKTEVTIEEEVDETDEEEKEDYENQVDHEQ
SLRGDVFFPQGKEAAAFGPLLAQRKVSVTRQEHEALCSKVDCSFSRGVCDWKQDTSDDFD
WNPADRDRGDGYYMAVPAFVGQKKDMGRLKLLLSDLKPKSTYCLIFSYRLAGERVGKLRV
FMANKKTAPVWEQDKGKDERWRTGKVEILQGAETTNSITFESERGKGKTGEIGVDNVILV
PGLCPEDT
Download sequence
Identical sequences 9031.ENSGALP00000026719 ENSGALP00000026719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]