SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000030526 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000030526
Domain Number 1 Region: 199-443
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-71
Family Nuclear receptor ligand-binding domain 0.000000000407
Further Details:      
 
Domain Number 2 Region: 89-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.1e-28
Family Nuclear receptor 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000030526   Gene: ENSGALG00000011294   Transcript: ENSGALT00000031162
Sequence length 445
Comment pep:known chromosome:WASHUC2:2:37252709:37300827:-1 gene:ENSGALG00000011294 transcript:ENSGALT00000031162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNQGYSSCDAQVLHSNNIYMEQAWAVNQPYTCSYPGNVFKSEYSDMDMALNQYNQPEYFT
EEKPTFSQVQSPSYSQKKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQ
KNLHPTYSCKYEGKCVIDKVTRNQCQECRFKKCIFVGMATDLVLDDSKRLAKRKLIEENR
EKRRREELQKTIGHKPEPTDEEWELIKIVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIV
NAPEGGKVDLEAFSQFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLR
AAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEVALLQAV
LLMSSDRPGLVCVERIEKCQEGFLLAFEHYINYRKHHVAHFWPKLLMKVTDLRMIGACHA
SRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences U3IEP0
ENSAPLP00000005712 ENSGALP00000030526 9031.ENSGALP00000018402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]