SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000031964 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000031964
Domain Number 1 Region: 48-458
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-97
Family Ras GEF 0.00056
Further Details:      
 
Domain Number 2 Region: 519-587
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 454-524
Classification Level Classification E-value
Superfamily EF-hand 0.000000000281
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000031964   Gene: ENSGALG00000009740   Transcript: ENSGALT00000032601
Sequence length 788
Comment pep:known chromosome:WASHUC2:5:32981964:33018608:1 gene:ENSGALG00000009740 transcript:ENSGALT00000032601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLGKKRETQQPAQGCSTAPESALELKQISHCHSHSNLTQVTMVPLGHLAKGATLEDLL
ETCIQSFDLEGNSYQNNQLLKMILTMHQFIISSADMLQKLTFSTYLSALEKKSSALCVKI
CYFVRYWITEFWVMFKMDSKLSTTMEAFQELVKANGEELHCRLIDTTQINSRDWSRKLTQ
RVKANSSKKRKVSLLFDHLEPEELSDHLTYLEFKSFRRISFSDYQSYIVNSCVKENPTME
RSIALCNGVSQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGGLCHSS
ISRLKETSSCVPHDVIKVFNEMTELLSSYRNYECYRRAYNECTNFKIPILGVHLKDLISL
HEAMPDYLEDKKINICKLYSLYNHINELIQLQEMPLPLEANMDLVHLLTLSLDLYYTEDE
IYELSYAREPRSHRAAPLTPSRPPVVADWASGVAPKPDPKTVSKHVQRMVDSVFKNYDHD
QDGYISQEEFEKIAASFPFSFCVMAKDSEGLISRDEITAYFMRASSIYSKLGLGFSHNFQ
ETTYLRPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLIVIECKRRHKTSVADSSPT
SALASSLCTVAVKEQFHGQEEGPFTFPNGVIEHNEDSKDRTIMLMGSSAQKISVRLKPAV
VHKGIQTDSVLLAGDVSHKSMEKKEKRILENPYLQPIPSSPRPSPLLSRKKAYVKWENKD
SNQKIKEEHREHHSYKPSYQELERERNILKADNEGLKMQLEQAHKTIESLTIQRRNHVID
NLQHKDCS
Download sequence
Identical sequences 9031.ENSGALP00000031964 ENSGALP00000031964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]