SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000035322 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000035322
Domain Number 1 Region: 137-319
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-51
Family Nuclear receptor ligand-binding domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 32-116
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-28
Family Nuclear receptor 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000035322   Gene: ENSGALG00000014237   Transcript: ENSGALT00000036096
Sequence length 393
Comment pep:known chromosome:WASHUC2:Un_random:11102506:11110946:-1 gene:ENSGALG00000014237 transcript:ENSGALT00000036096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLDTLSPASSPSSINFATAPGSIDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFR
RTIRLKLIYDKCDRNCKIQKKNRNKCQYCRFQKCLSVGMSHNAIRFGRMPRSEKAKLKAE
ILTGENYVEDSEMADLKSLAKRIHDAYLKNFNMNKVKARVILAGKTNNNPPFVIHDMDTL
CMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFSNLDLNDQVT
LLKYGVYEAIFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNA
LELDDSDISLFVAAIICCGVSSKIREGSHYSVFLKVESKFKEAVFAFTKWAEKQFVMKLE
TEKGHSYLRTIHKYFEKGTSLHPVNNLCYGNMY
Download sequence
Identical sequences ENSGALP00000035322 9031.ENSGALP00000035322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]