SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000035836 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000035836
Domain Number 1 Region: 1288-1422
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-33
Family Cadherin 0.00073
Further Details:      
 
Domain Number 2 Region: 1793-2017
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-32
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 3 Region: 421-549
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 2042-2235
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-29
Family Laminin G-like module 0.0056
Further Details:      
 
Domain Number 5 Region: 530-659
Classification Level Classification E-value
Superfamily Cadherin-like 9.03e-27
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 212-321
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 7 Region: 747-862
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-25
Family Cadherin 0.00085
Further Details:      
 
Domain Number 8 Region: 959-1080
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-25
Family Cadherin 0.00057
Further Details:      
 
Domain Number 9 Region: 1180-1307
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 10 Region: 862-962
Classification Level Classification E-value
Superfamily Cadherin-like 4e-24
Family Cadherin 0.00079
Further Details:      
 
Domain Number 11 Region: 1072-1184
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-22
Family Cadherin 0.00015
Further Details:      
 
Domain Number 12 Region: 315-440
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-20
Family Cadherin 0.0028
Further Details:      
 
Domain Number 13 Region: 1399-1513
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000186
Family Cadherin 0.0035
Further Details:      
 
Domain Number 14 Region: 119-224
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000214
Family Cadherin 0.0018
Further Details:      
 
Domain Number 15 Region: 639-747
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000614
Family Cadherin 0.0067
Further Details:      
 
Domain Number 16 Region: 1509-1611
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000942
Family Cadherin 0.024
Further Details:      
 
Domain Number 17 Region: 26-105
Classification Level Classification E-value
Superfamily Cadherin-like 0.000003
Family Cadherin 0.018
Further Details:      
 
Domain Number 18 Region: 2282-2319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000456
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000035836
Domain Number - Region: 2239-2272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000839
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000035836   Gene: ENSGALG00000015980   Transcript: ENSGALT00000036625
Sequence length 2530
Comment pep:known chromosome:WASHUC2:2:131092115:131093425:1 gene:ENSGALG00000015980 transcript:ENSGALT00000036625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDDWYLCHVTLLAPEEELLSWAMYPYPYLARVDPDARKGTLVYRLAARYSNSENTSAGVS
YTLIAGGEERFQVDVDTGIIVTTGLPLVWNKEYVVTVQASDEYGNKSPFASISILVGSRP
PQFTNMSYSVFVPENTPPGEKVAVVEAVSFQSQPLSYSLLTNPSGLFTVRQESGELLLTH
PVDYEGEHHLYHLLLKAVEAESALSSVAEVMVHITDENDCSPEFQNSIYSRDNIPETIPI
GTSLLQVLATDCDSGSNSEISYFIQSTDFSITRHGVISSNQRLNFERANHMYEFVVIAVD
KGHPPRTGTASVRIQMANVNDEAPVFSQPVYRTFLSEDAGPSTLVATVRAKDPDGDGVLY
LIAGGNEEGNFELDSQKGIIKLRRSPAPNLKGPQYILNITAIDDNVSGGPTPLSSFAEVI
VGVNDINNNKPVFRECTYYSDSTWVLENQPPGTYVLQVEAYDADLGVNGEVKYGLMHRDG
ASLGFSIDSDTGVITTTRSFDREEQKEHTLSVTATDQAPEPLIGICQITVLIADVNDNDP
KFENSRYQYFLSEDTPIGTSFLRVTAHDSDQGVNAAITYSMLAHQVQYFQINPSTGWVYV
NHRISQTTRISHYIVATDGGNRSSTVELTVTITNALSQPPRWEQSRYWVTVPENTIRDTR
IVTIKATSPLGDPRVTYNLEEGQVPETNMPIRFYLRPNRADGSASLLVAEPLDFETTKFF
SLTVRAQNVAMIPLASFTIVYVNVTDVNDNVPFFVSSNYEVSVPEGADVGTSVVQVLATD
LDSGLHGQVRYFILKDASEDYQFFTIEPETGIISTHASFDREKRASYLIEVQSQDSSESA
RPGVHGHPNTDTAYVRIFVSDVNDNAPAFPQPVYEVSVDEDRDVGSPVVTATADDRDEGA
NAKLRYQITSGNTKGVFDVEPEAGTVFIVQSLDYEEEQRYELRLVASDGKWENHTLIIIN
VVNKNDEAPVFTQNEYHGSILEELTDLPVFVLKVSATDPDQEADQNALSYSLHGQGAGSE
FSINENTGEISANRRLDREKRSTWRFLVLATDESGEGLTGFADVVIEVRDTNDNAPLFLC
VSDDCFMGYVPEDSPADTAVMEMTAVDLDDPKASTHAVLTYRIIQNVQNEINLNLFSINP
VSGTICTVLGSLDREKVDKYLLVVEARDGGGLTGTGTATILVTDVNDHAPVFLQRIYTAF
VSENASINTEVAVVSAMDRDEGENAMVTFSILDGDNDCKFSIETDKGNNCGFIHLRKQID
FEKPHERVFNLTLKAEDMDFFSIAHCVIYVEDANDHAPVFYPQFYEVASLAEDVPVGTKV
VQVSAVDLDSGLNGRFSFHLLNKSDPGGQFSVASDGWVIVAGVLDHETVTQYQLIVIATD
MGQPPLACSATVLVTLQDVNDNGPEFEAHYNPVVWENTASPQSVQMNETSTLLYAKDRDT
AANGAPFSFHLLSNFDSLGNFHLQDFHNGSALLTALHTFDREVHKVFHLPILITDSGIPP
MSSTNTLTVNIGDQNDHPHSAGYMECLIYSYDGILPTTVLGQVLAPDEDDWDRKIYQFEG
KTSRYFILNDNSGLLTIKEGTPPGTYNIKVRVIDGVWPDVVSTVKVIVKEIKDDALHNAG
SLQIKDTTPEEFISQFPEKESKYNQLKKLLSEIISVQLENVHIFSVLKSSQTRGVDVWFA
VYGPPYYKAEKLNGNVAASRAWLENILDINITQIGIDECVTANCTHSSGCISKYEHSHVP
TITTAGSISLVSVTVLSSALCSCAARESPHLSCSSYQTNPCLNGGTCVDTDLGYRCRCSA
NFHGPDCQQTKHSFKGHGYAWFPPLKPCFESRISLEFITEVADGLLLYQGPVARGQPGQL
EDFIALELSGGVPALTVSHSSGELFLQLSKKVNVADRRWHNIKIKSDGKAMKLVLDHCTN
GSVRHSGSVDKKISQVDLSACEASEETMGTWSMGRIFSGHQPLQLGGVKKILPYRDSQKR
FRGFVGCIRNVVVDTKVYDLEHPAESLNSSPGCILTDEMCQSAGMVSCGVHGRCVGDWGF
FHCDCAPGYAGPACDKVLPEWAFGRDSWIHYEPRNTLSTLSTRIQLMVRTRISRSTLLSL
ASADGSSFIRLEVDEGYFCVNFSLGGKSHSLRMKTLRINNGQWVLLTMERYNNEFTLRVN
SGGGDQEVTSVLGTDRWFEMDWASVVLGNRLPSHSESDFQGCLRDVQLNGQPLLVEGRST
EFGFVLRRQGVTMGCHSSACSSHPCYSPFLCVDLWRKYECRCPAGKVEVTDNLTGLRHCS
SSPCGHWTCRNGGTCVAQSQHKTICQCPEGYKGRWCEISQVKAGRPVGLSSGSILAISMC
LLVFLALLVSYTVWSQWGSSGFRKGGIYHIPEERESWEDVRENVFNYNEEGGGEHDQNAY
NVAELKKPLRSIPHFSLRATFPRSRTPTGPKRGSVPNRAQQKQSTSAVSSVPDFKEYVSQ
IIQDADNDLQNLPADTVHFYCLEGECSLAGSLSSLNSISGDEDLNYDCLQEWGSKFDKLK
ELYEPSHGHL
Download sequence
Identical sequences 9031.ENSGALP00000025705 ENSGALP00000035836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]