SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038557 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038557
Domain Number 1 Region: 905-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 2 Region: 328-380
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000558
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 1058-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.002
Further Details:      
 
Domain Number 4 Region: 1168-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000725
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 951-1001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 6 Region: 502-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 7 Region: 261-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000119
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 8 Region: 857-907
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000193
Family Laminin-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 1110-1165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Laminin-type module 0.0038
Further Details:      
 
Domain Number 10 Region: 451-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1011-1060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.079
Further Details:      
 
Domain Number 12 Region: 409-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000698
Family Laminin-type module 0.045
Further Details:      
 
Domain Number 13 Region: 1216-1263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000038557
Domain Number - Region: 98-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0638
Family beta-mannanase CBM 0.063
Further Details:      
 
Domain Number - Region: 1729-1830
Classification Level Classification E-value
Superfamily t-snare proteins 0.0785
Family t-snare proteins 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038557   Gene: ENSGALG00000007917   Transcript: ENSGALT00000039347
Sequence length 1835
Comment pep:known chromosome:WASHUC2:1:15939416:15942608:-1 gene:ENSGALG00000007917 transcript:ENSGALT00000039347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTDLLHTVLVGLQQAQDDCGAGSCHPAVGDLLLGRSKQLVASSTCGVNGPQKYCIIGYLE
AEQKCFVCDSRYPYNPYTQHNSHMIENVITAFEPDRKKKWWQSENGVDHVSIRLDLETLF
QFSHLILTFKTFRPAAMLVERSTDFGQTWKAFRYFAQDCAASFPNISSGPSKGVGDVICD
SRYSDTEPSTEGEVVLKALDPSFEIENPYVPYIQELITMTNLRINFTKLHTLGDALLGRR
HGDPLEKYYYAVYEMVVRGNCFCNGHASHCDPIQNLRGDVFHQPGMVHGRCICHHNTEGL
SCERCKDFYNDAPWRPAEGTQNNACKRCNCNGHSGRCHFDMAVYQASGGVSGGVCEDCQH
NTTGHHCDQCKLFFYQDPHKAISDPHACLPCSCNPEGTLHHGACESHTDPVLGTVAGRCL
CKENVEGVHCDKCKANHFGLRGSDPLGCQPCNCDAAGTLPFSVCDSTTGECLCQQFTTGR
RCEKCVEGYWGLGKSVYGCSPCDCDIGGSQDNLCSPEDGQCKCLPNIVGRQCNEPAPGYF
FLPLDYYIYEAEHATPLSGSAPLVCSWLFRHHMKNRSIRWLMQRIWHPSIMFLEHLFIYS
SKLGSHPQIVKPTTLPRCDVYFQKQGYEFMIENGKIVLNRSKKRSVRKAGLGQGAAERGQ
DLALEVVFRQPSTGRAVTWTGPGFIRVPSGAGLRFAIDNIPLAMDFTIAIRYEPETLEDW
LASVAVQPTGVSSSQHCKANSFSQEPHVFALPATKRIALLQTPVCLEPGTQYSVDAYFSQ
PSASVPKAKPFILIDSLGLIPRINSMENLCNKKDLDDYQKYHCVEIASEVGPHVLPEACA
RLIASMSARLHHGAVACKCNPQGSLNASCSRLGGQCHCKANVVGRCCDTCSAGSYGFGFH
GCYPCECHPQGSVSSLCDQVTGQCACLRDVDGRRCSQCLPGYFGFPHCRPCACHGFAELC
HPVTGECLNCSRFTAGSHCERCIDGYYGNPSNREPCRPCMCPGVPTSKRFFAHSCYQDSQ
TSQIVCNCLEGYSGNRCDECPSGFYKIPGSPGEECAPCPCNNNIDVTDPESCNRVTGECV
KCLHNTHGANCQFCKPGYFGSALNQDCRICKCNPAGVLPATCPGGDATCLCDPATGACLC
QPNVVGTTCDQCAPGYWDLAGGKGCQLCDCDLKNTQSNQCDQLTGQCQCKVGYGGKRCDE
CEENYFGNPQKHCISCNCNPEGTNWPQCDKATGVCNCRAGVTGRFCDQCGRGFEKDFPSC
RQCHLCFDEWDTEITALAQTVQGLMRFAASLEDKFHTLPPLRHISKLSHYKQQITQMSPI
RSMPYEFPDLTASIEDIGEEADRVYELLQQKLDLHRTIHYLSLKGKKTGLNKTEKMKGRS
MLVLNAISIATEAINNIRKHSEVSFLAEEKARETTPVVWHSQHTRQSVLTVIHKQAWEGS
KVLEQLKLIKIPGIQHLAEKICGVPGNHSCAAAACGGGPNCSGALPLSSSAFRKAEETAV
LLTNLTTQLQDPENQVEHIRRMAEDTKLKGSHFNGELERAKNQIKIDREVTKEFIKKVKN
FLSDESVPPEDIEQVASYVLQINLPLTPRELRSMIGKIRSIMAHCERYKLNANKRNGKME
VAQTLLVEARAADKAAKALPPVDKINDELKNAVSSQGRSKNTLMKLNEGIQGIRAQITQA
GNQMNKTSDELNDFSAKQSRLEDEITTLQTKVLMNRNQATNVRAGAEAAYKQAQKIDNEF
ADIKRKYAILQDKLKAKGPPKVTLQKVKQLKEEAEKLAEETEKKIRRITDLEKKLQDLNQ
TKQDKAEQLRQLEEQVIAIKNEITEQESKYSTCKS
Download sequence
Identical sequences ENSGALP00000038557 ENSGALP00000012842 9031.ENSGALP00000012842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]