SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000038706 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000038706
Domain Number 1 Region: 315-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000397
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 2 Region: 585-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000158
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 57-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000357
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 4 Region: 365-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000246
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 455-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000142
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 648-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000938
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 407-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000714
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000038706
Domain Number - Region: 113-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00221
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000038706   Gene: ENSGALG00000006013   Transcript: ENSGALT00000039496
Sequence length 770
Comment pep:known chromosome:WASHUC2:20:9443026:9467299:1 gene:ENSGALG00000006013 transcript:ENSGALT00000039496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSYACKGGRKTAGSTKPSKDSRAEARLNPPAELPRLGNATSDKTEGKKKGRPKAENQA
LKDIPLPLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGGAISEKLTYSCS
YCEAAFSSKTQLEKHRLWNHLDRPVPASKTENKVQKAIGKSSGKKRAAESSACPTIHPKQ
AKTEKALSQDHAENGECPAESRESKEFQIAAAEAIAAATPTAKSSSGKDGGQQGGSQASL
QEEDPERMKHRRKQKTPKKFTGEQPSISGTFGLKGLVKAEDKAKAHRAKKLEGSTNMEEL
KKKPPGAGVKKEAAVHLPAANLEDQWQREISEKGEVACPTCSVITRKTVVGLKKHMDVCQ
KLQDALKCQHCKKQFKSKAGLNYHTMAEHVSKPVPVETAALGEQEERERLRKVLKQMGKL
KCPNEGCVANFSSLMGYQYHQKRCGKQLAEADKPVFSCPHCGKKYKSKAGHDYHVRSEHP
ASVSPPDTSTTQEVGPSLPGGDCRAAEPVGRSEPGRAGPGKPPEEPEVKPEPTPVEDFER
TPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETKRLNYTRPGLPKLNPRL
LESWKNEVKEKGHINCPNNCCEAIYSSVSGLKAHLANCNKGEHSVGKYRCLLCQKEFSSE
SGVKYHIIKAHSENWFRTSSETTRKKKNREQLSSSKEEKKKSTNGKKRGRKPKERPLETS
LKSKESVAAKTNHKKSPEHWEGSRCXSDGGSRCSSDGDERGPKAPNQRKG
Download sequence
Identical sequences 9031.ENSGALP00000009661 ENSGALP00000038706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]