SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000039886 from Gallus gallus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000039886
Domain Number 1 Region: 145-481
Classification Level Classification E-value
Superfamily Subtilisin-like 1.03e-88
Family Subtilases 0.0000000276
Further Details:      
 
Domain Number 2 Region: 476-621
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-37
Family Proprotein convertase P-domain 0.00073
Further Details:      
 
Domain Number 3 Region: 61-135
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000731
Family Prohormone convertase 1 pro-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000039886   Gene: ENSGALG00000007271   Transcript: ENSGALT00000040683
Sequence length 741
Comment pep:known chromosome:WASHUC2:24:5350697:5366019:-1 gene:ENSGALG00000007271 transcript:ENSGALT00000040683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHRERRLRRWSAGAQAVRCVHTCLWLGAAWIPSVLSHGLTRGTELDDGRAVAHGPGELA
WAVSLDVPEEQVEQRAEQLARTAGLVNMGRIGELKGHYLFSYRPDSHAAPEPEAIRRSVD
TLFAQHDSVRWHSEQKLLKRSKRSLHFNDPKYPQQWHLNNRKSPGKDINVTGVWERNVTG
RGVTVVVVDDGVEHTIKDIQPNYSPEGSYDLNSNDPDPMPHPDEENGNHHGTRCAGEIAA
VPNNSFCTVGVAYGSRIAGIRVLDGPLTDSMEAIAFNKHYQINDIYSCSWGPDDDGKTVD
GPHQLGKAALQHGVIAGRRGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEMG
SMPFYAEECASMLAVTFSGGDKMMRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIAL
MLQVRPCLTWRDVQHIIVFTATKYEDRHAKWDVNRAGFSHSHQHGFGLLNAWRLVNAAKI
WESVPYLASYVSPVLKEGRSIPLLPQELEATWNVTTTDLQLSGMRTLEHVAVTVTITHPR
RGNLEIRLFCPSGMMSLIGTTRSMDSDPNGFADWTFSTVRCWGEEAQGTYRLVIRDTGDQ
SLRPGTLKQWQLTLYGSSWSPAEMKERQRLLEEAMSGQYLNNDFSLPCPPGLEIPEQQHY
TITANTLKTLLLLGCFLFWTFYYMLEVCLSRKNVGLDLTCHGSTACRWYQQGGKHRALEN
GLEMESVPLYREKEVEDIEVE
Download sequence
Identical sequences 9031.ENSGALP00000011767 ENSGALP00000039886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]