SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|339486856|ref|YP_004701384.1| from Pseudomonas putida S16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|339486856|ref|YP_004701384.1|
Domain Number 1 Region: 485-659
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.3e-35
Family Histidine kinase 0.0035
Further Details:      
 
Domain Number 2 Region: 681-792
Classification Level Classification E-value
Superfamily CheY-like 6.12e-28
Family CheY-related 0.0088
Further Details:      
 
Domain Number 3 Region: 4-155
Classification Level Classification E-value
Superfamily CheY-like 1.07e-23
Family CheY-related 0.0033
Further Details:      
 
Domain Number 4 Region: 130-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000101
Family Flavin-binding PAS domain 0.071
Further Details:      
 
Domain Number 5 Region: 290-394
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000967
Family Heme-binding PAS domain 0.032
Further Details:      
 
Domain Number 6 Region: 415-492
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000412
Family Homodimeric domain of signal transducing histidine kinase 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|339486856|ref|YP_004701384.1|
Sequence length 795
Comment multi-sensor hybrid histidine kinase [Pseudomonas putida S16]
Sequence
MQPTPLKLLMVEDNSMDAELTLMRLERSGLQVQAQLVFDHAGVEQALSEAHYDLILCDCV
LPGSSGTDVLAIAQRLAPDIPFIFLSGIYGEEHAVEMIRLGATDYVLKKNLPLLPKAVRR
ALTEVQERQRRRRAEEALADVEARARIAIDAAGMGTWDMRPQEGLLLWDDRCKTLFGLPT
DTEMSLEVFYAGIYPDDLPQVREAVEQAMCPEGGGLYRVEFRIAQPDGLEPRWLLSSGQS
RFVNDQCVRFSGVLQDIHTQRLATQALRQLNEMLGERVERRTRERDRAWELSQDLLAVLN
KDLTPVALNPAWEASLGLSRERLSQSSLLHLLPEHDQELMLTELAALAHGRTSARFVGRI
LDAGGLQRWLSWVVVPEDTLLYVVARDITSEREAALGLAEANARLREQIAERERIEAALQ
QMQRLEAVGQLTAGVAHDFNNLLTVILTGASFLERDLAKADLEKASARLKHIREAGERGA
KLTSQLLAFSRRQRLEPVALNLNRTLAGLEELLRRTLGGNVSVRLDLEPTLWQALTDPTQ
TEMIILNLAINARDAMPDGGQLTLSTRNTRIDARPQRPEDPDPGEYVMLSIRDTGCGMSE
EVLAKVFEPFFTTKDIGKGSGLGLAQVFGFAKQSGGGVRIDTTPGRGTQVAVYLPAVKGE
AVNEPMPSLLSHSTSESGCNRTVLLVDDDHLVRDMLGDVLRQYGYQVRQAHSGEQALALL
DEQIDLLLSDFAMPEFNGAQLALAARERYPHLPVVLLTGYAELQGLELPGSLVIQKPVKA
DELARLLNEMLGTAR
Download sequence
Identical sequences A0A059UVV0 A0A099MZL5 F8FYR5 V7DA68 V9UVM0
gi|568181316|ref|YP_008953861.1| WP_013971926.1.23948 WP_013971926.1.28354 WP_013971926.1.35335 WP_013971926.1.56258 WP_013971926.1.65739 WP_013971926.1.7288 WP_013971926.1.80759 gi|339486856|ref|YP_004701384.1| gi|568186747|ref|YP_008959290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]