SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|109689|e_gw1.39.508.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|109689|e_gw1.39.508.1
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000024
Family VPS36 N-terminal domain-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|109689|e_gw1.39.508.1
Sequence length 203
Sequence
MALNPQLHPSGFPLPFVNEVLALARDGVEFQVEKLPDVPSGKIVTKGTIYLSNIRLVFVA
RQPVGNFFAFDMPLMFIHEESFNQPIFFCNNLSGKVHPVIQEGANPALYAPYPFKILFKE
GGVGTFIPIFFGLLRSIRATESMRAAAQNPIPETQAPVDDMIRHAYIDPNDPTRLYLQQP
LEPESELRRRHYNAPIEQQVSHY
Download sequence
Identical sequences D8S6U6
jgi|Selmo1|109689|e_gw1.39.508.1 jgi|Selmo1|236300|fgenesh1_pm.C_scaffold_120000003 XP_002979038.1.77236 XP_002991508.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]