SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|109953|e_gw1.39.530.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|109953|e_gw1.39.530.1
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 9.16e-18
Family HMA, heavy metal-associated domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|109953|e_gw1.39.530.1
Sequence length 70
Sequence
QIVELKVAMTCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVKAEDVLQTVSKTGK
ATTFWPKEEQ
Download sequence
Identical sequences D8S6P6
XP_002978885.1.77236 XP_002988398.1.77236 jgi|Selmo1|109953|e_gw1.39.530.1 jgi|Selmo1|128073|e_gw1.88.77.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]