SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|112120|e_gw1.43.48.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|112120|e_gw1.43.48.1
Domain Number 1 Region: 275-653
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.84e-96
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 2 Region: 13-122
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-27
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Domain Number 3 Region: 652-719
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.01e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|112120|e_gw1.43.48.1
Sequence length 1090
Sequence
MADLARNGAVERDIEQAITALKKGAQLLKYGRRGKPKFCPFRLSNDETHLIWYSGKEEKS
LRLSSITRIVPGQRTANFQRYPRLEKEYQSFSLIYGNDRSLDLICKDKDEAEVWFVGLKA
LVSGGQLSRLRFDSRSECGPPSDSNSPATWSRISPASSPFGNVDNLPRQDGREAFRFQSP
YGSPPRYALQQRSFSPGAPSLDSSSKLFLENASTAGSLHSDMSSEPAASVLHLRGGAAAA
TSAAIPLDANFRVSMSSAVSSSSQGSGQEEGDALGDVFLWGESVGSGDGGIKTDSLLPKA
LESAVVLDVHHIACGNRHAALVTKQGEVFCWGDESGGRLGHGVDVDVAHPKLVEALATTN
TEFVACGEYHSCAVTLSGDLFTWGDGTHSYGLLGHGNDISHWTPKRVGGPLEGIRVSSVA
CGVWHTALVTSAGQLFTFGDGTFGVLGHGDKRSVALPKEVESLKGLKTVRVACGVWHTAA
VVEVMVGYSNAGGSSGKLFTWGDGDKGRLGHGDKEQKLVPTCVAALVDYNFKQVACGHTL
TVALTINGRVFTMGSSLYGQLGDVRADGKLPGLVEGRLWEAFVEEIACGAYHVAVLTAKT
EVYTWGKGANGRLGHGDVMDRNTPTLVEALKEKQVKSVACGSGFTAAICLHKWVSGADQS
LCSGCRQPFGFTRKRHNCYNCGHAFCHSCSARKALKASLAPNPAKPYRVCDPCFVKLKKG
GEVLLPGGGGGAGVPRKSMVATQGQQGSVKKPRKLELQPEQQQQQQQQQPQYHLNQALQF
SSSVQPWGAVDIPSVFNPYASGGSGSSLRPLVSALSVPTSRVASRSVSPLSRRPSPPRSA
TPTPTLAGLATPKTLVDELKRENDVVNHEVVKLKEQVEDLNRKLLQQDAELRRSAQQVQE
ALAIAGEESAKCQAAKEVIKQLTAQLKEMAERVPAGLHRHKQQQQQQFHHDQLPNGVHPP
VTTLDSLSVTDDEGGYSTAHLRYSLGALTPNLRSIAPDTNGLASPAQQQQASSRRPSPEP
ENDWVEQDQPGVYLTLCVLPAGGRELKRVRFSRKRFSEKQAEQWWQENRQRVHEQYNIRS
VDRTAPGNKL
Download sequence
Identical sequences D8S9K8
jgi|Selmo1|112120|e_gw1.43.48.1 XP_002980107.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]