SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|119914|e_gw1.61.109.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|119914|e_gw1.61.109.1
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily TPR-like 0.00000000019
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 2 Region: 145-261
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000573
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|119914|e_gw1.61.109.1
Sequence length 277
Sequence
IRGRTKEAEELWKQACQKYDKSVQLNWTSPQALNNWGLALQELGAIVPLKEKRAIVKVAI
KKFRAAIRLRFDFHRAVYNLGTVLYGLAEDTLRSGRRPSTHEGSAPELYSASAVYIAAAH
SLKPDYSVYRSALRLVRSMLPLPYLKVGYLTVPPIGNPLAPHSDWIKQWFVLDHEALYQM
EKVDQRSPTLGASSSPSKAPEGSHTRRVEVHDIVCVSPTADLSLPPGGCFVVDTPSGQHF
MIADNWEAVDGWVDAIRLVYTIFVRGKSEALATVLTA
Download sequence
Identical sequences D8SLE8
jgi|Selmo1|119914|e_gw1.61.109.1 XP_002984251.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]