SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|125093|e_gw1.77.13.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|125093|e_gw1.77.13.1
Domain Number 1 Region: 257-546
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-72
Family WD40-repeat 0.0000879
Further Details:      
 
Weak hits

Sequence:  jgi|Selmo1|125093|e_gw1.77.13.1
Domain Number - Region: 91-183
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0847
Family FCH domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|125093|e_gw1.77.13.1
Sequence length 548
Sequence
MLGTDKPFLLCFLSGTQFRGPGKGKQGTDAAVTRKPEVADDFVRNFLIRMGMTKTVATFE
TEWYQIREKKRILDSQIGLVPDEYVRSMKQDEIVTSLQHQLKQANLLAQYRHEMLEKLRR
ERNVHRMHHRRIAQEKNRLIVDVKRLRKHYAQYEPIIRELKKKYDTLMRTKSMIALERDR
LQALVIACFSLLLFLQLAASESGSESSYGTGTVSSKAKSAKDLAARSSSMSGQIYRAADP
LSIPRAVSAISQEPTIVKTFVLQKTFKGHTMPISNVVLHPKKPVGVTASDDSTWQMWGLP
AGDLIMTGDGHKSWVAGIDFHPNGMQLSSSSGDCTVKVWSFEKACCIHTFSDHTQAVWGV
SYHNSGEVLASASMDHTARIWDLCRGTLRGHVDSVNGCIWQPYNSILCTASSDKTVSLWD
ARSSLCVQTFYGHQSSCNHAAFDPKGETVVSVDANGIVKIWDIRKVAEYATIDVGPHPAN
KCAVDKSGYVVAIASSDSTIKCFQTYGEVVPIREFQGHTDAVQAVVFDRAGKYMVSAGSD
CTFRIWGP
Download sequence
Identical sequences D8SUE2
XP_002986906.1.77236 jgi|Selmo1|125093|e_gw1.77.13.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]