SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|129274|e_gw1.93.188.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|129274|e_gw1.93.188.1
Domain Number 1 Region: 241-324
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.17e-25
Family Vacuolar sorting protein domain 0.0078
Further Details:      
 
Domain Number 2 Region: 17-104
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000443
Family VPS36 N-terminal domain-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|129274|e_gw1.93.188.1
Sequence length 399
Sequence
MGSGSRWAERLLESGALSESGRPLLGPGEVECQLLDGVDIEVVDSGVEGDPLRSGLLILT
NARMFWVHQHSRSAFFLPLSSVSRISAPRKGLKSVFSSTLRLRGAAAAHSSVTLLLSFRG
HASSFDNLVSQLGAVLQSRAWETLPAAAVNPSTASASTPSSHWNPSRAGVSGILRKEQEQ
WEQTDKNLQEAFHDLNALMGKAKEMVLLADKMRARLLTEGSASGSQQELHDLLLSVGIAS
PVTKESAGALYHQQLSRQLADFVGSPLQSAGGMLALVDVYCLFNRARGTELISPEDLLQA
CDLWDRLDVPVMLRRFDSGALAIQIKSKSDDEVVARIMRLVGDLRTGVGAREAAKCLGVA
PALAKEHLFSAEARGFLCRDDGPDGLRFYTNFFKDAQFP
Download sequence
Identical sequences D8T0J5
jgi|Selmo1|129274|e_gw1.93.188.1 XP_002989120.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]