SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|132360|e_gw1.112.142.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|132360|e_gw1.112.142.1
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-41
Family BAR domain 0.002
Further Details:      
 
Domain Number 2 Region: 395-533
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.79e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00018
Further Details:      
 
Domain Number 3 Region: 553-574,622-711
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-25
Family Ankyrin repeat 0.00088
Further Details:      
 
Domain Number 4 Region: 279-335,402-425
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000228
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|132360|e_gw1.112.142.1
Sequence length 725
Sequence
LEESAEALRERCQKFFKGSRKYTEGLGEAYDGDIAFASALETFGGGHDDPISVAVGGPVM
TKFTIALREIGTYKEVLRSQVEHMLNDRLVQFASIDLQDVKVREKFLSLRKDAKSDVVAD
AEEDLRTARTLFEQARFNLVTALSNIEAKKKFEFLEAVSGSMDAHLRYFKQGYELLHQME
PYIHQVLTYAQQSRERANYEQAALADRMQEYRRQMERETQNASSEHDVISAADGIQAIGR
SSHKYIEAVMQSASRGKVWAAFNFCSFVTGVVSLQDDKTIAHHTVNLLTSTIKMDAEQSD
LRFCFRIISPSKSYTLQAENGMDRMDWMDKITGVIASLLNSQVTEQPRSPLNNFHQRSPS
ESSSVSASSDFEHSIGDDIKFSRRDRMYHNLELQERPLDILRRVSGNEFCADCGAADPDW
ASLNLGILICIECSGVHRNLGVHLSKVRSLTLDVRVWEPSVIGLFQSIGNAFANSMWEEQ
LPKYNHLLFPRTSFSIVCLCRTDMKVKPDARDPLAVKEKFIFAKYVEKRFVVKMKLDPRG
PSVARRIWDAVQANNKQSIVRLLINGDADANTTYELAFETTAGKQTVKGGPSPSPSSSLD
SLRLSEAAPSSISGKAGALTLSSDSGVENLRGQTLLQQACQVGDLSTVELLLQHGAQVNT
KDGIGRTPLHFCVECGRNLCAKLLLSRGANPAAVDRAGKTPLEVAMELGAVTDEELFVML
SESSR
Download sequence
Identical sequences jgi|Selmo1|132360|e_gw1.112.142.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]