SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Selmo1|134757|e_gw1.129.31.1 from Selaginella moellendorffii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Selmo1|134757|e_gw1.129.31.1
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.21e-27
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Selmo1|134757|e_gw1.129.31.1
Sequence length 122
Sequence
MLDELNSFLTGVQASPYRFSFSSLYSATKGFTKVLGSGGCGTVYEGMLHNGMKLAVKKLS
TQHGQKEFVTEVSALGNISHINIVKLYGFCADASHRLLVYELMPNGSLDRWIFSDNKDKL
DW
Download sequence
Identical sequences D8T936
jgi|Selmo1|134757|e_gw1.129.31.1 XP_002992103.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]